UniProt ID | ATP23_YEAST | |
---|---|---|
UniProt AC | P53722 | |
Protein Name | Mitochondrial inner membrane protease ATP23 | |
Gene Name | ATP23 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 227 | |
Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Intermembrane side . Associates loosely with the inner membrane. |
|
Protein Description | Has a dual role in the assembly of mitochondrial ATPase. Acts as a protease that removes the N-terminal 10 residues of mitochondrial ATPase CF(0) subunit 6 (ATP6) at the intermembrane space side. Also involved in the correct assembly of the membrane-embedded ATPase CF(0) particle, probably mediating association of ATP6 with the subunit 9 ring.. | |
Protein Sequence | MNSSGDNAGFEWWRRTMQYKTGIGLTPEEKTRYEDDSKARELKKECLKCYEYRDWMLKYSPTVRFMVQAITKLNKGSDSKFDDSKIICDYCPDWKGGGFHPELGILLCQNRLRDKWHLEDTLSHELIHYFDDLKWQIDWLNLKHHACSEIRASSLSGECRFWEEFKRRGFRTGFHVARGHQDCVRRRAIISVSGNPNCQSKEHAAKIVDEVWDSCFADTRPFDEIYR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
19 | Phosphorylation | WWRRTMQYKTGIGLT HHHHHHHHHCCCCCC | 10.33 | 28132839 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATP23_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATP23_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATP23_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...