UniProt ID | NAA38_YEAST | |
---|---|---|
UniProt AC | P23059 | |
Protein Name | N-alpha-acetyltransferase 38, NatC auxiliary subunit | |
Gene Name | MAK31 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 88 | |
Subcellular Localization | ||
Protein Description | Component of the NatC N-terminal acetyltransferase, which catalyzes acetylation of the N-terminus Met of L-A virus Gag protein. MAK31 is necessary for the structural stability of L-A double-stranded RNA-containing particles. Necessary for growth at 37 degrees Celsius as well as for maintenance of the killer plasmid.. | |
Protein Sequence | MDILKLSDFIGNTLIVSLTEDRILVGSLVAVDAQMNLLLDHVEERMGSSSRMMGLVSVPRRSVKTIMIDKPVLQELTANKVELMANIV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NAA38_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NAA38_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NAA38_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NAA35_YEAST | MAK10 | physical | 10688190 | |
NAA35_YEAST | MAK10 | physical | 10504710 | |
NAA30_YEAST | MAK3 | physical | 10504710 | |
NAA35_YEAST | MAK10 | physical | 16554755 | |
NAA30_YEAST | MAK3 | physical | 16554755 | |
PAN3_YEAST | PAN3 | physical | 18719252 | |
RPI1_YEAST | RPI1 | physical | 18719252 | |
TRIM1_HUMAN | MID2 | physical | 27107014 | |
IKZF1_HUMAN | IKZF1 | physical | 27107014 | |
IKZF3_HUMAN | IKZF3 | physical | 27107014 | |
RIM3A_HUMAN | RIMBP3 | physical | 27107014 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...