dbPTM

NAA38_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NAA38_YEAST
UniProt AC	P23059
Protein Name	N-alpha-acetyltransferase 38, NatC auxiliary subunit
Gene Name	MAK31
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	88
Subcellular Localization
Protein Description	Component of the NatC N-terminal acetyltransferase, which catalyzes acetylation of the N-terminus Met of L-A virus Gag protein. MAK31 is necessary for the structural stability of L-A double-stranded RNA-containing particles. Necessary for growth at 37 degrees Celsius as well as for maintenance of the killer plasmid..
Protein Sequence	MDILKLSDFIGNTLIVSLTEDRILVGSLVAVDAQMNLLLDHVEERMGSSSRMMGLVSVPRRSVKTIMIDKPVLQELTANKVELMANIV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
65	Phosphorylation	VPRRSVKTIMIDKPV CCCCCCEEEEECCHH	17.39	21126336
77	Phosphorylation	KPVLQELTANKVELM CHHHHHHHCCCHHHH	27.68	21126336

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of NAA38_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NAA38_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NAA38_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NAA35_YEAST	MAK10	physical	10688190
NAA35_YEAST	MAK10	physical	10504710
NAA30_YEAST	MAK3	physical	10504710
NAA35_YEAST	MAK10	physical	16554755
NAA30_YEAST	MAK3	physical	16554755
PAN3_YEAST	PAN3	physical	18719252
RPI1_YEAST	RPI1	physical	18719252
TRIM1_HUMAN	MID2	physical	27107014
IKZF1_HUMAN	IKZF1	physical	27107014
IKZF3_HUMAN	IKZF3	physical	27107014
RIM3A_HUMAN	RIMBP3	physical	27107014

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NAA38_YEAST

Related Literatures of Post-Translational Modification