dbPTM

MTC3_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MTC3_YEAST
UniProt AC	P53077
Protein Name	Maintenance of telomere capping protein 3, mitochondrial
Gene Name	MTC3
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	123
Subcellular Localization	Mitochondrion .
Protein Description	May be involved in telomere capping..
Protein Sequence	MMGRNGIRLALKRSFSTYQPPVVEITNITKLWPTLRPEVRDEIKEYLRWRMQEDWRHIPLEETKAAYFLSYGPCGGRSKGNEWNVGYTGMRIVFNLVLFGGAATAFYNWKQDKKLEEQLRDLV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
16	Phosphorylation	LALKRSFSTYQPPVV HHHHHCCCCCCCCEE	27.70	27017623
17	Phosphorylation	ALKRSFSTYQPPVVE HHHHCCCCCCCCEEE	24.94	27017623
18	Phosphorylation	LKRSFSTYQPPVVEI HHHCCCCCCCCEEEE	20.16	27017623

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MTC3_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MTC3_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MTC3_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CND2_YEAST	BRN1	genetic	27708008
SWC4_YEAST	SWC4	genetic	27708008
RPF2_YEAST	RPF2	genetic	27708008
CLP1_YEAST	CLP1	genetic	27708008
HEL2_YEAST	HEL2	genetic	27708008
TECR_YEAST	TSC13	genetic	27708008
ARP2_YEAST	ARP2	genetic	27708008
PRP11_YEAST	PRP11	genetic	27708008
GLE1_YEAST	GLE1	genetic	27708008
TIM22_YEAST	TIM22	genetic	27708008
CDC37_YEAST	CDC37	genetic	27708008
SEC7_YEAST	SEC7	genetic	27708008
ACT_YEAST	ACT1	genetic	27708008
RPN12_YEAST	RPN12	genetic	27708008
DPOD2_YEAST	POL31	genetic	27708008
RU1C_YEAST	YHC1	genetic	27708008
TAF11_YEAST	TAF11	genetic	27708008
CBF3B_YEAST	CEP3	genetic	27708008
LCB1_YEAST	LCB1	genetic	27708008
XRN2_YEAST	RAT1	genetic	27708008
TYSY_YEAST	CDC21	genetic	27708008
PROF_YEAST	PFY1	genetic	27708008
APC5_YEAST	APC5	genetic	27708008
ULP1_YEAST	ULP1	genetic	27708008
DIM1_YEAST	DIM1	genetic	27708008
PRP4_YEAST	PRP4	genetic	27708008
FTH1_YEAST	FTH1	genetic	27708008
GPR1_YEAST	GPR1	genetic	27708008
SAC3_YEAST	SAC3	genetic	27708008
UME6_YEAST	UME6	genetic	27708008
MSH4_YEAST	MSH4	genetic	27708008
TIM13_YEAST	TIM13	genetic	27708008
PHB2_YEAST	PHB2	genetic	27708008
RPI1_YEAST	RPI1	genetic	27708008
YJ24_YEAST	KCH1	genetic	27708008
CSN12_YEAST	YJR084W	genetic	27708008
IME1_YEAST	IME1	genetic	27708008
KKQ8_YEAST	KKQ8	genetic	27708008
LTHAD_YEAST	SRY1	genetic	27708008
RNP1_YEAST	RNP1	genetic	27708008
PP2B2_YEAST	CMP2	genetic	27708008
MAC1_YEAST	MAC1	genetic	27708008
ATP23_YEAST	ATP23	genetic	27708008
FABD_YEAST	MCT1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MTC3_YEAST

Related Literatures of Post-Translational Modification