| UniProt ID | DIM1_YEAST | |
|---|---|---|
| UniProt AC | P41819 | |
| Protein Name | Dimethyladenosine transferase | |
| Gene Name | DIM1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 318 | |
| Subcellular Localization | Cytoplasm . Nucleus, nucleolus . | |
| Protein Description | Specifically dimethylates two adjacent adenosines in the loop of a conserved hairpin near the 3'-end of 18S rRNA in the 40S particle.. | |
| Protein Sequence | MGKAAKKKYSGATSSKQVSAEKHLSSVFKFNTDLGQHILKNPLVAQGIVDKAQIRPSDVVLEVGPGTGNLTVRILEQAKNVVAVEMDPRMAAELTKRVRGTPVEKKLEIMLGDFMKTELPYFDICISNTPYQISSPLVFKLINQPRPPRVSILMFQREFALRLLARPGDSLYCRLSANVQMWANVTHIMKVGKNNFRPPPQVESSVVRLEIKNPRPQVDYNEWDGLLRIVFVRKNRTISAGFKSTTVMDILEKNYKTFLAMNNEMVDDTKGSMHDVVKEKIDTVLKETDLGDKRAGKCDQNDFLRLLYAFHQVGIHFS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Acetylation | -MGKAAKKKYSGATS -CCHHCCCCCCCCCC | 52.82 | 25381059 | |
| 8 | Acetylation | MGKAAKKKYSGATSS CCHHCCCCCCCCCCC | 43.90 | 25381059 | |
| 16 | Acetylation | YSGATSSKQVSAEKH CCCCCCCCCCCHHHH | 55.26 | 22865919 | |
| 22 | Acetylation | SKQVSAEKHLSSVFK CCCCCHHHHHHHHHH | 49.95 | 24489116 | |
| 25 | Phosphorylation | VSAEKHLSSVFKFNT CCHHHHHHHHHHCCC | 24.95 | 21440633 | |
| 29 | Acetylation | KHLSSVFKFNTDLGQ HHHHHHHHCCCCHHH | 35.23 | 25381059 | |
| 40 | Acetylation | DLGQHILKNPLVAQG CHHHHHHCCHHHHCC | 56.78 | 22865919 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DIM1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DIM1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DIM1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...