| UniProt ID | LRP1_YEAST | |
|---|---|---|
| UniProt AC | P38801 | |
| Protein Name | Exosome complex protein LRP1 | |
| Gene Name | LRP1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 184 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Required for exosome-dependent processing of pre-rRNA and small nucleolar RNA (snRNA) precursors. Involved in processing of 35S pre-rRNA at the A0, A1 and A2 sites. Required for activity of RRP6 in 7S pre-rRNA processing. Also has a role in 3'-processing of U4 and U5 small nuclear RNAs (snRNAs). Acts as a mRNA export factor. Mediates mRNA degradation upon UV irradiation. Maintains genome integrity where it is involved in both non-homologous end joining (NHEJ) and homologous recombination pathway repair of double strand DNA breaks. During NHEJ, required for joining 3'-overhanging ends. Also involved in telomere length regulation and maintenance.. | |
| Protein Sequence | MEDIEKIKPYVRSFSKALDELKPEIEKLTSKSLDEQLLLLSDERAKLELINRYAYVLSSLMFANMKVLGVKDMSPILGELKRVKSYMDKAKQYDNRITKSNEKSQAEQEKAKNIISNVLDGNKNQFEPSISRSNFQGKHTKFENDELAESTTTKIIDSTDHIRKASSKKSKRLDKVGKKKGGKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 16 | Acetylation | PYVRSFSKALDELKP HHHHHHHHHHHHHHH | 51.46 | 24489116 | |
| 22 | Acetylation | SKALDELKPEIEKLT HHHHHHHHHHHHHHH | 38.26 | 24489116 | |
| 27 | Acetylation | ELKPEIEKLTSKSLD HHHHHHHHHHCCCHH | 63.83 | 24489116 | |
| 53 | Phosphorylation | KLELINRYAYVLSSL HHHHHHHHHHHHHHH | 9.59 | 24961812 | |
| 55 | Phosphorylation | ELINRYAYVLSSLMF HHHHHHHHHHHHHHH | 7.93 | 24961812 | |
| 58 | Phosphorylation | NRYAYVLSSLMFANM HHHHHHHHHHHHCCC | 16.04 | 24961812 | |
| 59 | Phosphorylation | RYAYVLSSLMFANMK HHHHHHHHHHHCCCE | 21.49 | 24961812 | |
| 74 | Phosphorylation | VLGVKDMSPILGELK ECCCCCCHHHHHHHH | 20.94 | 21440633 | |
| 81 | Acetylation | SPILGELKRVKSYMD HHHHHHHHHHHHHHH | 51.33 | 24489116 | |
| 85 | Phosphorylation | GELKRVKSYMDKAKQ HHHHHHHHHHHHHHH | 23.88 | 27017623 | |
| 129 | Phosphorylation | NKNQFEPSISRSNFQ CCCCCCCCCCCCCCC | 26.46 | 24909858 | |
| 131 | Phosphorylation | NQFEPSISRSNFQGK CCCCCCCCCCCCCCC | 33.71 | 22369663 | |
| 138 | Acetylation | SRSNFQGKHTKFEND CCCCCCCCCCCCCCH | 37.00 | 25381059 | |
| 141 | Acetylation | NFQGKHTKFENDELA CCCCCCCCCCCHHHH | 50.85 | 24489116 | |
| 158 | Phosphorylation | TTTKIIDSTDHIRKA HCCCHHCCHHHHHHH | 25.90 | 27214570 | |
| 175 | Acetylation | KKSKRLDKVGKKKGG HHHHHHHHHCCCCCC | 58.44 | 25381059 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LRP1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LRP1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LRP1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
