| UniProt ID | GAR1_YEAST | |
|---|---|---|
| UniProt AC | P28007 | |
| Protein Name | H/ACA ribonucleoprotein complex subunit GAR1 | |
| Gene Name | GAR1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 205 | |
| Subcellular Localization | Nucleus, nucleolus . | |
| Protein Description | Non-catalytic component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP), which catalyzes pseudouridylation of rRNA and is required for ribosome biogenesis. [PubMed: 9303321] | |
| Protein Sequence | MSFRGGNRGGRGGFRGGFRGGRTGSARSFQQGPPDTVLEMGAFLHPCEGDIVCRSINTKIPYFNAPIYLENKTQVGKVDEILGPLNEVFFTIKCGDGVQATSFKEGDKFYIAADKLLPIERFLPKPKVVGPPKPKNKKKRSGAPGGRGGASMGRGGSRGGFRGGRGGSSFRGGRGGSSFRGGSRGGSFRGGSRGGSRGGFRGGRR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Methylation | ----MSFRGGNRGGR ----CCCCCCCCCCC | 44.81 | 12756332 | |
| 4 | Asymmetric dimethylarginine | ----MSFRGGNRGGR ----CCCCCCCCCCC | 44.81 | - | |
| 8 | Asymmetric dimethylarginine | MSFRGGNRGGRGGFR CCCCCCCCCCCCCCC | 52.82 | - | |
| 8 | Methylation | MSFRGGNRGGRGGFR CCCCCCCCCCCCCCC | 52.82 | 12756332 | |
| 11 | Asymmetric dimethylarginine | RGGNRGGRGGFRGGF CCCCCCCCCCCCCCC | 44.90 | - | |
| 11 | Methylation | RGGNRGGRGGFRGGF CCCCCCCCCCCCCCC | 44.90 | 12756332 | |
| 15 | Asymmetric dimethylarginine | RGGRGGFRGGFRGGR CCCCCCCCCCCCCCC | 47.83 | - | |
| 15 | Methylation | RGGRGGFRGGFRGGR CCCCCCCCCCCCCCC | 47.83 | 12756332 | |
| 19 | Asymmetric dimethylarginine | GGFRGGFRGGRTGSA CCCCCCCCCCCCCCC | 50.35 | - | |
| 19 | Methylation | GGFRGGFRGGRTGSA CCCCCCCCCCCCCCC | 50.35 | 12756332 | |
| 23 | Phosphorylation | GGFRGGRTGSARSFQ CCCCCCCCCCCCCCC | 38.47 | 30377154 | |
| 25 | Phosphorylation | FRGGRTGSARSFQQG CCCCCCCCCCCCCCC | 21.64 | 30377154 | |
| 28 | Phosphorylation | GRTGSARSFQQGPPD CCCCCCCCCCCCCCC | 27.42 | 30377154 | |
| 36 | Phosphorylation | FQQGPPDTVLEMGAF CCCCCCCCEEEECCE | 32.53 | 30377154 | |
| 59 | Acetylation | VCRSINTKIPYFNAP EEEECCCCCCCCCCC | 36.88 | 24489116 | |
| 59 | Ubiquitination | VCRSINTKIPYFNAP EEEECCCCCCCCCCC | 36.88 | 23749301 | |
| 72 | Ubiquitination | APIYLENKTQVGKVD CCEEECCCCCCCCHH | 30.84 | 17644757 | |
| 77 | Ubiquitination | ENKTQVGKVDEILGP CCCCCCCCHHHHHCC | 47.89 | 22106047 | |
| 108 | Acetylation | TSFKEGDKFYIAADK EECCCCCEEEEEECC | 51.42 | 24489116 | |
| 115 | Acetylation | KFYIAADKLLPIERF EEEEEECCCCCHHHH | 47.39 | 24489116 | |
| 147 | Methylation | RSGAPGGRGGASMGR CCCCCCCCCCCCCCC | 46.41 | 12756332 | |
| 147 | Asymmetric dimethylarginine | RSGAPGGRGGASMGR CCCCCCCCCCCCCCC | 46.41 | - | |
| 154 | Methylation | RGGASMGRGGSRGGF CCCCCCCCCCCCCCC | 37.34 | 12756332 | |
| 154 | Asymmetric dimethylarginine | RGGASMGRGGSRGGF CCCCCCCCCCCCCCC | 37.34 | - | |
| 158 | Methylation | SMGRGGSRGGFRGGR CCCCCCCCCCCCCCC | 53.15 | 12756332 | |
| 158 | Asymmetric dimethylarginine | SMGRGGSRGGFRGGR CCCCCCCCCCCCCCC | 53.15 | - | |
| 162 | Asymmetric dimethylarginine | GGSRGGFRGGRGGSS CCCCCCCCCCCCCCC | 50.35 | - | |
| 162 | Methylation | GGSRGGFRGGRGGSS CCCCCCCCCCCCCCC | 50.35 | 12756332 | |
| 165 | Asymmetric dimethylarginine | RGGFRGGRGGSSFRG CCCCCCCCCCCCCCC | 49.47 | - | |
| 165 | Methylation | RGGFRGGRGGSSFRG CCCCCCCCCCCCCCC | 49.47 | 12756332 | |
| 171 | Methylation | GRGGSSFRGGRGGSS CCCCCCCCCCCCCCC | 48.91 | 12756332 | |
| 171 | Asymmetric dimethylarginine | GRGGSSFRGGRGGSS CCCCCCCCCCCCCCC | 48.91 | - | |
| 174 | Methylation | GSSFRGGRGGSSFRG CCCCCCCCCCCCCCC | 49.47 | 12756332 | |
| 174 | Asymmetric dimethylarginine | GSSFRGGRGGSSFRG CCCCCCCCCCCCCCC | 49.47 | - | |
| 180 | Asymmetric dimethylarginine | GRGGSSFRGGSRGGS CCCCCCCCCCCCCCC | 50.97 | - | |
| 180 | Methylation | GRGGSSFRGGSRGGS CCCCCCCCCCCCCCC | 50.97 | 12756332 | |
| 184 | Asymmetric dimethylarginine | SSFRGGSRGGSFRGG CCCCCCCCCCCCCCC | 57.68 | - | |
| 184 | Methylation | SSFRGGSRGGSFRGG CCCCCCCCCCCCCCC | 57.68 | 12756332 | |
| 189 | Methylation | GSRGGSFRGGSRGGS CCCCCCCCCCCCCCC | 50.70 | 12756332 | |
| 189 | Asymmetric dimethylarginine | GSRGGSFRGGSRGGS CCCCCCCCCCCCCCC | 50.70 | - | |
| 193 | Methylation | GSFRGGSRGGSRGGF CCCCCCCCCCCCCCC | 57.68 | 12756332 | |
| 193 | Asymmetric dimethylarginine | GSFRGGSRGGSRGGF CCCCCCCCCCCCCCC | 57.68 | - | |
| 197 | Asymmetric dimethylarginine | GGSRGGSRGGFRGGR CCCCCCCCCCCCCCC | 53.15 | - | |
| 197 | Methylation | GGSRGGSRGGFRGGR CCCCCCCCCCCCCCC | 53.15 | 12756332 | |
| 201 | Asymmetric dimethylarginine | GGSRGGFRGGRR--- CCCCCCCCCCCC--- | 50.35 | - | |
| 201 | Methylation | GGSRGGFRGGRR--- CCCCCCCCCCCC--- | 50.35 | 12756332 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GAR1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GAR1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GAR1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
