dbPTM

YMP0_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YMP0_YEAST
UniProt AC	Q03687
Protein Name	Uncharacterized membrane protein YMR010W
Gene Name	YMR010W
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	405
Subcellular Localization	Membrane Multi-pass membrane protein.
Protein Description
Protein Sequence	MSTTGPLDATLIRDVAVATATKASYDMSDTLYSYLPKVDQFYIPEWLTMQFIANNLISFTPLFSYGTTIISIEKCKTALGFSIDICATMLIASILRISYYLITPYEITLLRQSLVMIFIQLILLRTSLKYRPDEYKYQNLTDVESLSHLIHDIWFEFFSCINRPKFLSEDWKNLIKSLSFTNLLKFSFKIFLAFFYKILKFFDPNFKRIGAFWQWDDDKNFWRFLALFATVQILVTFFISNILNWDSLAQGLGSIIGSLGLLVESLLPLPQIAILYKLKSVQGFKLILLVSWLCGDTLKITYLIFGAKNISALFVIFALFQMSLDFYIGGQYIYYRYYYPKLRHQHHPNDSNSPSDEDESEMYELDLFNTLQKDVEKALKQDSNDTSDSPQDDQVGKSQAQAVTL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
377	Acetylation	TLQKDVEKALKQDSN HHHHHHHHHHHCCCC	59.89	24489116

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YMP0_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YMP0_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YMP0_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KIN4_YEAST	KIN4	physical	16554755
GOSR1_YEAST	GOS1	genetic	16269340
TRS20_YEAST	TRS20	genetic	16269340
OST6_YEAST	OST6	genetic	16269340
SCS7_YEAST	SCS7	genetic	16269340
PMT2_YEAST	PMT2	genetic	16269340
SAC1_YEAST	SAC1	genetic	16269340
ORM2_YEAST	ORM2	genetic	16269340
GAS1_YEAST	GAS1	genetic	16269340
BST1_YEAST	BST1	genetic	16269340
AP3D_YEAST	APL5	genetic	16269340
RGP1_YEAST	RGP1	genetic	16269340
CHO2_YEAST	CHO2	genetic	16269340
GET1_YEAST	GET1	genetic	16269340
TLG2_YEAST	TLG2	genetic	16269340
OSTB_YEAST	WBP1	genetic	16269340
TRS85_YEAST	TRS85	genetic	16269340
ERV29_YEAST	ERV29	genetic	16269340
UBC6_YEAST	UBC6	genetic	16269340
ICE2_YEAST	ICE2	genetic	16269340
VPS5_YEAST	VPS5	physical	18467557
CYP8_YEAST	CPR8	physical	18467557
PIN2_YEAST	PIN2	physical	18467557
RBD2_YEAST	RBD2	physical	18467557
COPG_YEAST	SEC21	physical	18467557
YMP0_YEAST	YMR010W	physical	18467557
VPS5_YEAST	VPS5	physical	22615397
COPB_YEAST	SEC26	genetic	23891562
VPS17_YEAST	VPS17	genetic	23891562
SRO7_YEAST	SRO7	genetic	23891562
MSMO_YEAST	ERG25	genetic	23891562
ELO3_YEAST	ELO3	genetic	23891562
THIL_YEAST	ERG10	genetic	23891562
TPM1_YEAST	TPM1	genetic	23891562
ATC3_YEAST	DRS2	genetic	27708008
RCY1_YEAST	RCY1	genetic	27708008
H4_YEAST	HHF1	genetic	27708008
AIM4_YEAST	AIM4	genetic	27708008
GOSR1_YEAST	GOS1	genetic	27708008
YKH7_YEAST	YKL077W	genetic	27708008
GAS1_YEAST	GAS1	genetic	27708008
AIM44_YEAST	AIM44	genetic	27708008
AP1M1_YEAST	APM1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YMP0_YEAST

Related Literatures of Post-Translational Modification