UniProt ID | RBD2_YEAST | |
---|---|---|
UniProt AC | Q12270 | |
Protein Name | Rhomboid protein 2 | |
Gene Name | RBD2 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 262 | |
Subcellular Localization |
Golgi apparatus membrane Multi-pass membrane protein . Golgi apparatus, cis-Golgi network membrane Multi-pass membrane protein . |
|
Protein Description | Probable serine protease.. | |
Protein Sequence | MNWKSYVFPGGHPPAALTTGLVVFLTAIYLLSFIFALREDLSLAPESLFKLQMSRLSLYPLIHLSLPHLLFNVLAIWAPLNLFEETHGTVYTGVFLNLSALFAGILYCLLGKLLYPEALVAGASGWCFTLFAYYSFKESQIRPRTRIFRTDYSIPTLYTPLVLLVAIAVVIPGSSFWGHFFGLCVGYAIGYKESWFNKITPPGWIITKIEKSLDGLIRLIPWGIKYYRDEDIDRTKDYEPLMSTETPLPLHNDNSGTVLGTA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
208 | Acetylation | PPGWIITKIEKSLDG CCCCHHHHHHHHHHH | 38.16 | 24489116 | |
211 | Acetylation | WIITKIEKSLDGLIR CHHHHHHHHHHHHHH | 60.85 | 24489116 | |
255 | Phosphorylation | LPLHNDNSGTVLGTA CCCCCCCCCCEEECC | 38.41 | 21440633 | |
257 | Phosphorylation | LHNDNSGTVLGTA-- CCCCCCCCEEECC-- | 16.63 | 19779198 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RBD2_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RBD2_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RBD2_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...