UniProt ID | AIM41_YEAST | |
---|---|---|
UniProt AC | Q12032 | |
Protein Name | Altered inheritance of mitochondria protein 41, mitochondrial | |
Gene Name | AIM41 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 185 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | ||
Protein Sequence | MFRQSIRPLVSNRLTFIRYNSSPAYTAAVSLLKGDLKKAMIAKDEMKKTAIRNMLSAIKNKEIALKGKSADEYSLYDMYSKLISQRKDSINEFLANKRDDLVAKEQGEMDIIKKYMDQLPVSSELDIDQNVKKLLDALKTKAGEKKVQIKEIMGEIDWKSLPTEWKTSPTAIKNSIVKQFKEIFK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
59 | Acetylation | RNMLSAIKNKEIALK HHHHHHHHCCCHHHC | 62.78 | 24489116 | |
61 | 2-Hydroxyisobutyrylation | MLSAIKNKEIALKGK HHHHHHCCCHHHCCC | 45.56 | - | |
69 | Phosphorylation | EIALKGKSADEYSLY CHHHCCCCCCHHHHH | 50.01 | 22369663 | |
73 | Phosphorylation | KGKSADEYSLYDMYS CCCCCCHHHHHHHHH | 12.43 | 22369663 | |
74 | Phosphorylation | GKSADEYSLYDMYSK CCCCCHHHHHHHHHH | 20.57 | 22369663 | |
76 | Phosphorylation | SADEYSLYDMYSKLI CCCHHHHHHHHHHHH | 7.85 | 22369663 | |
79 | Phosphorylation | EYSLYDMYSKLISQR HHHHHHHHHHHHHCC | 10.35 | 22369663 | |
80 | Phosphorylation | YSLYDMYSKLISQRK HHHHHHHHHHHHCCH | 17.85 | 22369663 | |
81 | Acetylation | SLYDMYSKLISQRKD HHHHHHHHHHHCCHH | 32.14 | 24489116 | |
89 | Phosphorylation | LISQRKDSINEFLAN HHHCCHHHHHHHHHH | 30.28 | 28889911 | |
133 | Acetylation | DIDQNVKKLLDALKT CCCHHHHHHHHHHHH | 50.42 | 24489116 | |
159 | Acetylation | IMGEIDWKSLPTEWK HHHCCCHHHCCCCCC | 38.06 | 24489116 | |
160 | Phosphorylation | MGEIDWKSLPTEWKT HHCCCHHHCCCCCCC | 35.01 | 21126336 | |
173 | Acetylation | KTSPTAIKNSIVKQF CCCCHHHHHHHHHHH | 42.02 | 24489116 | |
181 | Acetylation | NSIVKQFKEIFK--- HHHHHHHHHHHC--- | 47.62 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AIM41_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AIM41_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AIM41_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DMA1_YEAST | DMA1 | physical | 10688190 | |
THIK_YEAST | POT1 | genetic | 20093466 | |
MRT4_YEAST | MRT4 | genetic | 20093466 | |
MSB4_YEAST | MSB4 | genetic | 20093466 | |
RBD2_YEAST | RBD2 | genetic | 20093466 | |
THIK_YEAST | POT1 | genetic | 27708008 | |
ATG41_YEAST | ICY2 | genetic | 27708008 | |
SNT1_YEAST | SNT1 | genetic | 29674565 | |
ABP1_YEAST | ABP1 | genetic | 29674565 | |
COG3_YEAST | COG3 | genetic | 29674565 | |
NU145_YEAST | NUP145 | genetic | 29674565 | |
IMPX_YEAST | IMP2 | genetic | 29674565 | |
FOLC_YEAST | RMA1 | genetic | 29674565 | |
PXL1_YEAST | PXL1 | genetic | 29674565 | |
RCE1_YEAST | RCE1 | genetic | 29674565 | |
MGR2_YEAST | MGR2 | genetic | 29674565 | |
RSP5_YEAST | RSP5 | genetic | 29674565 | |
RS30A_YEAST | RPS30A | genetic | 29674565 | |
RS30B_YEAST | RPS30A | genetic | 29674565 | |
CHS5_YEAST | CHS5 | genetic | 29674565 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...