| UniProt ID | ATG41_YEAST | |
|---|---|---|
| UniProt AC | Q12048 | |
| Protein Name | Autophagy-related protein 41 {ECO:0000303|PubMed:26565778} | |
| Gene Name | ATG41 {ECO:0000303|PubMed:26565778} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 136 | |
| Subcellular Localization |
Preautophagosomal structure membrane Peripheral membrane protein . Shows a peri-mitochondrial distribution similar to ATG9 (PubMed:26565778). |
|
| Protein Description | Involved in both selective and non-selective autophagy. [PubMed: 26565778 Does not appear to play a role in determining the size of autophagosomes, but rather influences their formation rate] | |
| Protein Sequence | MSSVESSPISRYEDEVFPLSFSNVAFEPPMLSHSPDRSTYADDFSQSYQQELLTFPLSYPIVDESECTHTKDKTDSNIITSTEDDCMFDMEFNGNAASAVAAASKESNSASGFAFASNDAFANVAQQNYRLWLSSV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSSVESSPI ------CCCCCCCCC | 19795423 | ||
| 3 | Phosphorylation | -----MSSVESSPIS -----CCCCCCCCCC | 19795423 | ||
| 6 | Phosphorylation | --MSSVESSPISRYE --CCCCCCCCCCCCC | 22369663 | ||
| 7 | Phosphorylation | -MSSVESSPISRYED -CCCCCCCCCCCCCC | 22369663 | ||
| 20 | Phosphorylation | EDEVFPLSFSNVAFE CCCCEECCCCCCCCC | 28132839 | ||
| 22 | Phosphorylation | EVFPLSFSNVAFEPP CCEECCCCCCCCCCC | 28889911 | ||
| 32 | Phosphorylation | AFEPPMLSHSPDRST CCCCCCCCCCCCCCC | 28132839 | ||
| 34 | Phosphorylation | EPPMLSHSPDRSTYA CCCCCCCCCCCCCCC | 28889911 | ||
| 105 | Ubiquitination | SAVAAASKESNSASG HHHHHHHHCCCCCCC | 17644757 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATG41_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATG41_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATG41_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
