UniProt ID | TRX1_YEAST | |
---|---|---|
UniProt AC | P22217 | |
Protein Name | Thioredoxin-1 | |
Gene Name | TRX1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 103 | |
Subcellular Localization |
Nucleus . Cytoplasm . Golgi apparatus membrane Peripheral membrane protein . Mitochondrion intermembrane space . |
|
Protein Description | Participates as a hydrogen donor in redox reactions through the reversible oxidation of its active center dithiol to a disulfide, accompanied by the transfer of 2 electrons and 2 protons. It is involved in many cellular processes, including deoxyribonucleotide synthesis, repair of oxidatively damaged proteins, protein folding, sulfur metabolism, and redox homeostasis. Thioredoxin-dependent enzymes include phosphoadenosine-phosphosulfate reductase MET16, alkyl-hydroperoxide reductase DOT5, thioredoxin peroxidases TSA1 and TSA2, alkyl hydroperoxide reductase AHP1, and peroxiredoxin HYR1. Thioredoxin is also involved in protection against reducing stress. As part of the LMA1 complex, it is involved in the facilitation of vesicle fusion such as homotypic vacuole and ER-derived COPII vesicle fusion with the Golgi. This activity does not require the redox mechanism.. | |
Protein Sequence | MVTQFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAANA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Ubiquitination | --MVTQFKTASEFDS --CCCCCCCHHHHHH | 33.11 | 24961812 | |
7 | Phosphorylation | -MVTQFKTASEFDSA -CCCCCCCHHHHHHH | 36.38 | 22369663 | |
9 | Phosphorylation | VTQFKTASEFDSAIA CCCCCCHHHHHHHHH | 43.99 | 22369663 | |
13 | Phosphorylation | KTASEFDSAIAQDKL CCHHHHHHHHHHCCE | 27.22 | 28889911 | |
42 | Acetylation | MIAPMIEKFSEQYPQ HHHHHHHHHHHHCCC | 43.17 | 24489116 | |
54 | Ubiquitination | YPQADFYKLDVDELG CCCCCEEECCHHHHH | 37.90 | 23749301 | |
54 | Acetylation | YPQADFYKLDVDELG CCCCCEEECCHHHHH | 37.90 | 24489116 | |
54 | Succinylation | YPQADFYKLDVDELG CCCCCEEECCHHHHH | 37.90 | 23954790 | |
66 | Ubiquitination | ELGDVAQKNEVSAMP HHHHHHHHCCCCCCC | 45.39 | 23749301 | |
70 | Phosphorylation | VAQKNEVSAMPTLLL HHHHCCCCCCCEEEE | 16.81 | 27017623 | |
79 | Acetylation | MPTLLLFKNGKEVAK CCEEEEEECCCHHHH | 65.83 | 22865919 | |
86 | Ubiquitination | KNGKEVAKVVGANPA ECCCHHHHHHCCCHH | 42.50 | 23749301 | |
86 | Acetylation | KNGKEVAKVVGANPA ECCCHHHHHHCCCHH | 42.50 | 24489116 | |
96 | Ubiquitination | GANPAAIKQAIAANA CCCHHHHHHHHHHCC | 29.02 | 23749301 | |
96 | Acetylation | GANPAAIKQAIAANA CCCHHHHHHHHHHCC | 29.02 | 24489116 | |
96 | Succinylation | GANPAAIKQAIAANA CCCHHHHHHHHHHCC | 29.02 | 23954790 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRX1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRX1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRX1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-9 AND SER-13, AND MASSSPECTROMETRY. |