TIM10_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TIM10_YEAST
• UniProt AC: P87108
• Protein Name: Mitochondrial import inner membrane translocase subunit TIM10
• Gene Name: TIM10
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 93
• Subcellular Localization: Mitochondrion inner membrane ; Peripheral membrane protein ; Intermembrane side . Mitochondrion intermembrane space .
• Protein Description: Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. Compared to TIM9, it may function as a substrate sensor..
• Protein Sequence: MSFLGFGGGQPQLSSQQKIQAAEAELDLVTDMFNKLVNNCYKKCINTSYSEGELNKNESSCLDRCVAKYFETNVQVGENMQKMGQSFNAAGKF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSFLGFGGG ------CCCCCCCCC	29.22	24909858
42	Ubiquitination	KLVNNCYKKCINTSY HHHHHHHHHHHCCCC	43.28	23749301
42	Acetylation	KLVNNCYKKCINTSY HHHHHHHHHHHCCCC	43.28	25381059
43	Ubiquitination	LVNNCYKKCINTSYS HHHHHHHHHHCCCCC	17.55	22817900
43	Acetylation	LVNNCYKKCINTSYS HHHHHHHHHHCCCCC	17.55	24489116
47	Phosphorylation	CYKKCINTSYSEGEL HHHHHHCCCCCCCCC	14.77	30377154
48	Phosphorylation	YKKCINTSYSEGELN HHHHHCCCCCCCCCC	23.36	30377154
50	Phosphorylation	KCINTSYSEGELNKN HHHCCCCCCCCCCCC	38.60	30377154
56	Ubiquitination	YSEGELNKNESSCLD CCCCCCCCCCCHHHH	74.78	23749301
86	Phosphorylation	NMQKMGQSFNAAGKF HHHHHHHHCCCCCCC	18.10	30377154

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TIM10_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TIM10_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TIM10_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TIM12_YEAST	TIM12	physical	9889188
TIM9_YEAST	TIM9	physical	9889188
TIM22_YEAST	TIM22	physical	9430585
TIM9_YEAST	TIM9	physical	12882976
TIM9_YEAST	TIM9	genetic	9822593
TIM10_YEAST	TIM10	physical	12138093
TIM22_YEAST	TIM22	physical	18458057
TIM54_YEAST	TIM54	physical	18458057
TIM9_YEAST	TIM9	genetic	20457929
TIM22_YEAST	TIM22	physical	22152483
MIA40_YEAST	MIA40	physical	22918950
ERV1_YEAST	ERV1	physical	22918950
TOM70_YEAST	TOM70	physical	22918950
TOM40_YEAST	TOM40	physical	22918950
TOM22_YEAST	TOM22	physical	22918950
CCPR_YEAST	CCP1	physical	22918950
TIM23_YEAST	TIM23	physical	22918950
TIM14_YEAST	PAM18	physical	22918950
TAZ1_YEAST	TAZ1	physical	24078306
TEX11_HUMAN	TEX11	physical	27107014

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.