| UniProt ID | ERV1_YEAST | |
|---|---|---|
| UniProt AC | P27882 | |
| Protein Name | Mitochondrial FAD-linked sulfhydryl oxidase ERV1 | |
| Gene Name | ERV1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 189 | |
| Subcellular Localization | Mitochondrion intermembrane space . | |
| Protein Description | FAD-dependent sulfhydryl oxidase that catalyzes disulfide bond formation. Required for the import and folding of small cysteine-containing proteins in the mitochondrial intermembrane space (IMS). Forms a redox cycle with MIA40 that involves a disulfide relay system. Important for maintaining the cysteine residues in MIA40 in an oxidized state. Reduced ERV1 is reoxidized by cytochrome c. Required for the maturation of cytoplasmic, but not of mitochondrial Fe/S proteins.. | |
| Protein Sequence | MKAIDKMTDNPPQEGLSGRKIIYDEDGKPCRSCNTLLDFQYVTGKISNGLKNLSSNGKLAGTGALTGEASELMPGSRTYRKVDPPDVEQLGRSSWTLLHSVAASYPAQPTDQQKGEMKQFLNIFSHIYPCNWCAKDFEKYIRENAPQVESREELGRWMCEAHNKVNKKLRKPKFDCNFWEKRWKDGWDE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 139 | Acetylation | WCAKDFEKYIRENAP CHHHHHHHHHHHHCC | 46.07 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ERV1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ERV1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ERV1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MIA40_YEAST | MIA40 | physical | 17972915 | |
| CYC1_YEAST | CYC1 | physical | 17972915 | |
| SP382_YEAST | SPP382 | physical | 18719252 | |
| MIA40_YEAST | MIA40 | physical | 19667201 | |
| ERV1_YEAST | ERV1 | physical | 19667201 | |
| PHB2_YEAST | PHB2 | genetic | 20093466 | |
| VPS55_YEAST | VPS55 | genetic | 20093466 | |
| DCOR_YEAST | SPE1 | genetic | 20093466 | |
| ENV10_YEAST | ENV10 | genetic | 20093466 | |
| TGS1_YEAST | TGS1 | genetic | 20093466 | |
| PMA2_YEAST | PMA2 | genetic | 20093466 | |
| YME1_YEAST | YME1 | genetic | 20093466 | |
| BRR1_YEAST | BRR1 | genetic | 20093466 | |
| MIA40_YEAST | MIA40 | physical | 20367271 | |
| ERV1_YEAST | ERV1 | physical | 20188670 | |
| CYC1_YEAST | CYC1 | physical | 20188670 | |
| CYC7_YEAST | CYC7 | physical | 20188670 | |
| MIA40_YEAST | MIA40 | physical | 18787558 | |
| ERV1_YEAST | ERV1 | physical | 17959605 | |
| TIM9_YEAST | TIM9 | physical | 18852299 | |
| TIM10_YEAST | TIM10 | physical | 19011240 | |
| MIA40_YEAST | MIA40 | physical | 17959605 | |
| COXM1_YEAST | CMC1 | physical | 22767599 | |
| ERV1_YEAST | ERV1 | physical | 24625320 | |
| MIA40_YEAST | MIA40 | physical | 24625320 | |
| ERV1_YEAST | ERV1 | physical | 26221027 | |
| TIM17_YEAST | TIM17 | physical | 27502485 | |
| GOPC_HUMAN | GOPC | physical | 27107014 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
