| UniProt ID | COXM1_YEAST | |
|---|---|---|
| UniProt AC | P36064 | |
| Protein Name | COX assembly mitochondrial protein | |
| Gene Name | CMC1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 111 | |
| Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Intermembrane side . Mitochondrion intermembrane space . Imported into the mitochondria via the mitochondrial MIA40-ERV1 machinery. |
|
| Protein Description | Required for mitochondrial cytochrome c oxidase (COX) assembly and respiration. Binds copper. May be involved in copper trafficking and distribution to mitochondrial COX and SOD1.. | |
| Protein Sequence | MEQNKDPQMISKHSSRLPIWVLSPREEQQARKNLKTETYKKCANFVQAMADCAKANGMKVFPTCDKQRDEMKSCLLFYQTDEKYLDGERDKIVLEKINKLEKLCQKQSSTK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 11 | Phosphorylation | NKDPQMISKHSSRLP CCCHHHHHHCCCCCC | 20.97 | 27017623 | |
| 14 | Phosphorylation | PQMISKHSSRLPIWV HHHHHHCCCCCCEEE | 22.38 | 27017623 | |
| 96 | Acetylation | RDKIVLEKINKLEKL CHHHHHHHHHHHHHH | 47.63 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COXM1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COXM1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COXM1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...