UniProt ID | COXM1_YEAST | |
---|---|---|
UniProt AC | P36064 | |
Protein Name | COX assembly mitochondrial protein | |
Gene Name | CMC1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 111 | |
Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Intermembrane side . Mitochondrion intermembrane space . Imported into the mitochondria via the mitochondrial MIA40-ERV1 machinery. |
|
Protein Description | Required for mitochondrial cytochrome c oxidase (COX) assembly and respiration. Binds copper. May be involved in copper trafficking and distribution to mitochondrial COX and SOD1.. | |
Protein Sequence | MEQNKDPQMISKHSSRLPIWVLSPREEQQARKNLKTETYKKCANFVQAMADCAKANGMKVFPTCDKQRDEMKSCLLFYQTDEKYLDGERDKIVLEKINKLEKLCQKQSSTK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Phosphorylation | NKDPQMISKHSSRLP CCCHHHHHHCCCCCC | 20.97 | 27017623 | |
14 | Phosphorylation | PQMISKHSSRLPIWV HHHHHHCCCCCCEEE | 22.38 | 27017623 | |
96 | Acetylation | RDKIVLEKINKLEKL CHHHHHHHHHHHHHH | 47.63 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COXM1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COXM1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COXM1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...