UniProt ID | COXM2_YEAST | |
---|---|---|
UniProt AC | Q3E7A4 | |
Protein Name | COX assembly mitochondrial protein 2 | |
Gene Name | CMC2 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 109 | |
Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Intermembrane side . Mitochondrion intermembrane space . Imported into the mitochondria via the mitochondrial MIA40-ERV1 machinery. |
|
Protein Description | Required for mitochondrial cytochrome c oxidase (COX) assembly and respiration. May be involved in copper trafficking and distribution to mitochondrial COX and SOD1.. | |
Protein Sequence | MHPQLEAERFHSCLDFINALDKCHQKEYYKRIFGLCNNEKDALNKCLKEASLNNKKRAVIESRIKRADVEKRWKKIEEEEYGEDAILKTILDRQYAKKKQESDNDANSK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Phosphorylation | LEAERFHSCLDFINA HHHHHHHHHHHHHHH | 17.42 | 30377154 | |
40 | Acetylation | FGLCNNEKDALNKCL HHHCCCHHHHHHHHH | 50.88 | 24489116 | |
51 | Phosphorylation | NKCLKEASLNNKKRA HHHHHHHHCCHHHHH | 32.49 | 27214570 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COXM2_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COXM2_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COXM2_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...