UniProt ID | YO385_YEAST | |
---|---|---|
UniProt AC | Q08909 | |
Protein Name | Uncharacterized protein YOR385W | |
Gene Name | YOR385W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 290 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | ||
Protein Sequence | MRGFSGQPLSDDDNYRIEKTQRNTIPERLHFSRERNMPIASIFGTRGYFVFSSEQSYDKFKQTNFNISTLDADGVGVPLFHIVQSYNVIGKITRSSPDFYIYKYVLQGVQDPPLYSDCKVICQDKVFRLCKILYCEIYAHQGFFETKYDFFYPSKTQPVKKYQIIKQSNMRDLYSTLDGMRFRWHVKFYSDHFRLMFLDEDRLNYSNSNQKERQKPDQGKSKAPDFVIGHYTRTFSDILPRSTSKCSNLIIGEHSKPDSLGITTVPDLTQEFACQGALIHYLLHIERERK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MRGFSGQPLSDD ---CCCCCCCCCCCC | 39.07 | 22369663 | |
10 | Phosphorylation | GFSGQPLSDDDNYRI CCCCCCCCCCCCCCC | 45.75 | 22369663 | |
15 | Phosphorylation | PLSDDDNYRIEKTQR CCCCCCCCCCCHHHC | 21.69 | 22369663 | |
41 | Phosphorylation | ERNMPIASIFGTRGY HCCCCEEHHCCCCEE | 21.12 | 27017623 | |
125 | Ubiquitination | CKVICQDKVFRLCKI CEEEHHHHHHHHHHH | 19.86 | 23749301 | |
211 | Ubiquitination | NYSNSNQKERQKPDQ CCCCCCHHHHCCCCC | 60.14 | 23749301 | |
215 | Ubiquitination | SNQKERQKPDQGKSK CCHHHHCCCCCCCCC | 57.70 | 22817900 | |
236 | Phosphorylation | GHYTRTFSDILPRST EECCCCHHHHCCCCC | 24.11 | 30377154 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YO385_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YO385_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YO385_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RSP5_YEAST | RSP5 | physical | 11283351 | |
RSP5_YEAST | RSP5 | physical | 18719252 | |
RL6B_YEAST | RPL6B | genetic | 27708008 | |
CSM1_YEAST | CSM1 | genetic | 27708008 | |
NHP10_YEAST | NHP10 | genetic | 27708008 | |
IES1_YEAST | IES1 | genetic | 27708008 | |
MED5_YEAST | NUT1 | genetic | 27708008 | |
OPI1_YEAST | OPI1 | genetic | 27708008 | |
AYR1_YEAST | AYR1 | genetic | 27708008 | |
YJ24_YEAST | KCH1 | genetic | 27708008 | |
METW_YEAST | YLL058W | genetic | 27708008 | |
MMS22_YEAST | MMS22 | genetic | 27708008 | |
ROM2_YEAST | ROM2 | genetic | 27708008 | |
SOK2_YEAST | SOK2 | genetic | 27708008 | |
GBLP_YEAST | ASC1 | genetic | 27708008 | |
RAD14_YEAST | RAD14 | genetic | 27708008 | |
UBP8_YEAST | UBP8 | genetic | 27708008 | |
TGS1_YEAST | TGS1 | genetic | 27708008 | |
WDR6_YEAST | RTT10 | genetic | 27708008 | |
DVL2_HUMAN | DVL2 | physical | 27107014 | |
WWP2_HUMAN | WWP2 | physical | 27107014 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...