dbPTM

HUA2_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HUA2_YEAST
UniProt AC	Q12134
Protein Name	Protein HUA2
Gene Name	HUA2
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	243
Subcellular Localization	Cytoplasm .
Protein Description	May have a role in actin patch assembly..
Protein Sequence	MQQTKFGKMYLDHDSVVEYSEDEIVEADRITLGYKKRLSMIENQMRHLLEDFSLDVQQIEPILADLQKYYDAFLQLLQKRNKSLQCKRSTHQPVPSPMNSQTSTNAKVNLSGKLMKFQLNSVQKFDEENILRILQNKIEFEHYFQIDKGKKQKVLLLAVYQCLNGPTRLHKVLNIEGIIHNNSIRTILGKQVSSSKWTVFLYDVKLVLLAHRQDVPNLETSKMIVRYGDLFPCALYFKDHTAY

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
20	Phosphorylation	HDSVVEYSEDEIVEA CCCCEEECHHHHEEE	25.68	27214570
96	Phosphorylation	STHQPVPSPMNSQTS CCCCCCCCCCCCCCC	36.69	21440633

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HUA2_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HUA2_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HUA2_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PMT3_YEAST	PMT3	genetic	16269340
LCF1_YEAST	FAA1	genetic	16269340
HUA2_YEAST	HUA2	physical	11283351
HUA2_YEAST	HUA2	physical	18719252
SLT2_YEAST	SLT2	genetic	20526336
RV161_YEAST	RVS161	genetic	20526336
LSP1_YEAST	LSP1	genetic	20526336
SSD1_YEAST	SSD1	genetic	21987634
LCF1_YEAST	FAA1	genetic	21987634
PMT3_YEAST	PMT3	genetic	21987634
TPM1_YEAST	TPM1	genetic	23891562
ICE2_YEAST	ICE2	genetic	23891562
PFD4_YEAST	GIM3	genetic	23891562
DVL2_HUMAN	DVL2	physical	27107014
SDCB2_HUMAN	SDCBP2	physical	27107014

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HUA2_YEAST

Related Literatures of Post-Translational Modification