| UniProt ID | PFD4_YEAST | |
|---|---|---|
| UniProt AC | P53900 | |
| Protein Name | Prefoldin subunit 4 | |
| Gene Name | GIM3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 129 | |
| Subcellular Localization | ||
| Protein Description | Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.. | |
| Protein Sequence | MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLDDVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLEDKQRDIDSRLDALKAILYAKFGDNINLER | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MELLPQGQ -------CCCCCCCC | 8.05 | 22814378 | |
| 12 | Phosphorylation | PQGQRNNTQVTFEDQ CCCCCCCCCCCHHHH | 28.15 | 27017623 | |
| 27 | Acetylation | QKINEFSKLIMRKDA HHHHHHHHHHHHHHH | 47.56 | 24489116 | |
| 87 | Ubiquitination | KVTAQLEKDAERLDN CHHHHHHHHHHHHHH | 71.48 | 23749301 | |
| 102 | Acetylation | KIETLEDKQRDIDSR HHHHHHHHHHCHHHH | 37.55 | 24489116 | |
| 114 | Acetylation | DSRLDALKAILYAKF HHHHHHHHHHHHHHH | 34.79 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PFD4_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PFD4_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PFD4_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
