| UniProt ID | NDE1_YEAST | |
|---|---|---|
| UniProt AC | Q06568 | |
| Protein Name | Nuclear distribution protein nudE homolog 1 | |
| Gene Name | NDL1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 189 | |
| Subcellular Localization | Nucleus . Cytoplasm, cytoskeleton . Also localizes to the plus ends of cytoplasmic microtubules, and this requires PAC1. | |
| Protein Description | Required for nuclear migration to the bud neck during cell division. Targets cytoplasmic dynein to microtubule plus ends thereby promoting dynein-mediated microtubule sliding along the bud cortex and consequently the movement of the mitotic spindle to the bud neck.. | |
| Protein Sequence | MVPNLDLETAIQIISSLETQLSELEGATKEYENDLEQVISKLKSDLLESQQQNKCNKKQITDLEIQVDELENENIQLRNKIETLQLESDRRLERNVLLEHELLDTKEALQKLRVSKEEATSGETRRNTRSLPSQNKKMKLFKDTIKVSTTSSTLYLQNMAKTNNAARSHCNIPNTQITQSTVIATTSSV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 142 | Acetylation | NKKMKLFKDTIKVST CHHCHHHHCEEEEEC | 65.48 | 25381059 | |
| 149 | Phosphorylation | KDTIKVSTTSSTLYL HCEEEEECCCCHHHH | 33.41 | 28889911 | |
| 150 | Phosphorylation | DTIKVSTTSSTLYLQ CEEEEECCCCHHHHH | 17.11 | 28889911 | |
| 155 | Phosphorylation | STTSSTLYLQNMAKT ECCCCHHHHHHHHHH | 13.31 | 28889911 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDE1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDE1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDE1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
