UniProt ID | NDE1_YEAST | |
---|---|---|
UniProt AC | Q06568 | |
Protein Name | Nuclear distribution protein nudE homolog 1 | |
Gene Name | NDL1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 189 | |
Subcellular Localization | Nucleus . Cytoplasm, cytoskeleton . Also localizes to the plus ends of cytoplasmic microtubules, and this requires PAC1. | |
Protein Description | Required for nuclear migration to the bud neck during cell division. Targets cytoplasmic dynein to microtubule plus ends thereby promoting dynein-mediated microtubule sliding along the bud cortex and consequently the movement of the mitotic spindle to the bud neck.. | |
Protein Sequence | MVPNLDLETAIQIISSLETQLSELEGATKEYENDLEQVISKLKSDLLESQQQNKCNKKQITDLEIQVDELENENIQLRNKIETLQLESDRRLERNVLLEHELLDTKEALQKLRVSKEEATSGETRRNTRSLPSQNKKMKLFKDTIKVSTTSSTLYLQNMAKTNNAARSHCNIPNTQITQSTVIATTSSV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
142 | Acetylation | NKKMKLFKDTIKVST CHHCHHHHCEEEEEC | 65.48 | 25381059 | |
149 | Phosphorylation | KDTIKVSTTSSTLYL HCEEEEECCCCHHHH | 33.41 | 28889911 | |
150 | Phosphorylation | DTIKVSTTSSTLYLQ CEEEEECCCCHHHHH | 17.11 | 28889911 | |
155 | Phosphorylation | STTSSTLYLQNMAKT ECCCCHHHHHHHHHH | 13.31 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDE1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDE1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDE1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...