| UniProt ID | FKBP2_YEAST | |
|---|---|---|
| UniProt AC | P32472 | |
| Protein Name | Peptidyl-prolyl cis-trans isomerase FPR2 | |
| Gene Name | FPR2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 135 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Peripheral membrane protein. Is not secreted and probably localized in the endoplasmic reticulum. |
|
| Protein Description | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. FKBP-13 may play a role in protein trafficking in the ER.. | |
| Protein Sequence | MMFNIYLFVTFFSTILAGSLSDLEIGIIKRIPVEDCLIKAMPGDKVKVHYTGSLLESGTVFDSSYSRGSPIAFELGVGRVIKGWDQGVAGMCVGEKRKLQIPSSLAYGERGVPGVIPPSADLVFDVELVDVKSAA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 96 | Acetylation | AGMCVGEKRKLQIPS CCEEECCCEEECCCC | 49.24 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FKBP2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FKBP2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FKBP2_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PUF4_YEAST | PUF4 | physical | 16554755 | |
| MPD2_YEAST | MPD2 | physical | 16554755 | |
| AP3M_YEAST | APM3 | genetic | 16269340 | |
| HSP72_YEAST | SSA2 | physical | 22940862 | |
| FKBP2_YEAST | FPR2 | physical | 22940862 | |
| SSB1_YEAST | SSB1 | physical | 22940862 | |
| RPB7_YEAST | RPB7 | genetic | 27708008 | |
| RSP5_YEAST | RSP5 | genetic | 27708008 | |
| SEC65_YEAST | SEC65 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
