UniProt ID | FKBP2_YEAST | |
---|---|---|
UniProt AC | P32472 | |
Protein Name | Peptidyl-prolyl cis-trans isomerase FPR2 | |
Gene Name | FPR2 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 135 | |
Subcellular Localization |
Endoplasmic reticulum membrane Peripheral membrane protein. Is not secreted and probably localized in the endoplasmic reticulum. |
|
Protein Description | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. FKBP-13 may play a role in protein trafficking in the ER.. | |
Protein Sequence | MMFNIYLFVTFFSTILAGSLSDLEIGIIKRIPVEDCLIKAMPGDKVKVHYTGSLLESGTVFDSSYSRGSPIAFELGVGRVIKGWDQGVAGMCVGEKRKLQIPSSLAYGERGVPGVIPPSADLVFDVELVDVKSAA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
96 | Acetylation | AGMCVGEKRKLQIPS CCEEECCCEEECCCC | 49.24 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FKBP2_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FKBP2_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FKBP2_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PUF4_YEAST | PUF4 | physical | 16554755 | |
MPD2_YEAST | MPD2 | physical | 16554755 | |
AP3M_YEAST | APM3 | genetic | 16269340 | |
HSP72_YEAST | SSA2 | physical | 22940862 | |
FKBP2_YEAST | FPR2 | physical | 22940862 | |
SSB1_YEAST | SSB1 | physical | 22940862 | |
RPB7_YEAST | RPB7 | genetic | 27708008 | |
RSP5_YEAST | RSP5 | genetic | 27708008 | |
SEC65_YEAST | SEC65 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...