NAT5_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NAT5_YEAST
• UniProt AC: Q08689
• Protein Name: N-alpha-acetyltransferase NAT5 {ECO:0000305}
• Gene Name: NAT5 {ECO:0000303|PubMed:25886145, ECO:0000312|SGD:S000005779}
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 176
• Subcellular Localization: Cytoplasm .
• Protein Description: N-alpha-acetyltransferase that acetylates the N-terminus of proteins that retain their initiating methionine. [PubMed: 25886145 Has a broad substrate specificity: able to acetylate the initiator methionine of most peptides]
• Protein Sequence: MGRDICTLDNVYANNLGMLTKLAHVTVPNLYQDAFFSALFAEDSLVAKNKKPSSKKDVHFTQMAYYSEIPVGGLVAKLVPKKQNELSLKGIQIEFLGVLPNYRHKSIGSKLLKFAEDKCSECHQHNVFVYLPAVDDLTKQWFIAHGFEQVGETVNNFIKGVNGDEQDAILLKKHIS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
110	Ubiquitination	RHKSIGSKLLKFAED CCCCHHHHHHHHHHH	53.26	23749301
172	Ubiquitination	EQDAILLKKHIS--- HHHHHEEHHCCC---	38.57	23749301
172	Acetylation	EQDAILLKKHIS--- HHHHHEEHHCCC---	38.57	24489116

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NAT5_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NAT5_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NAT5_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ARD1_YEAST	ARD1	physical	14517307
NAT1_YEAST	NAT1	physical	14517307
PALF_YEAST	RIM8	physical	16554755
SSB1_YEAST	SSB1	physical	19536198
RL3_YEAST	RPL3	physical	17541948
RS3_YEAST	RPS3	physical	17541948
RL21B_YEAST	RPL21B	genetic	27708008
AIM44_YEAST	AIM44	genetic	27708008
YP022_YEAST	YPR022C	genetic	27708008
CTF4_YEAST	CTF4	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.