UniProt ID | NAT5_YEAST | |
---|---|---|
UniProt AC | Q08689 | |
Protein Name | N-alpha-acetyltransferase NAT5 {ECO:0000305} | |
Gene Name | NAT5 {ECO:0000303|PubMed:25886145, ECO:0000312|SGD:S000005779} | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 176 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | N-alpha-acetyltransferase that acetylates the N-terminus of proteins that retain their initiating methionine. [PubMed: 25886145 Has a broad substrate specificity: able to acetylate the initiator methionine of most peptides] | |
Protein Sequence | MGRDICTLDNVYANNLGMLTKLAHVTVPNLYQDAFFSALFAEDSLVAKNKKPSSKKDVHFTQMAYYSEIPVGGLVAKLVPKKQNELSLKGIQIEFLGVLPNYRHKSIGSKLLKFAEDKCSECHQHNVFVYLPAVDDLTKQWFIAHGFEQVGETVNNFIKGVNGDEQDAILLKKHIS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
110 | Ubiquitination | RHKSIGSKLLKFAED CCCCHHHHHHHHHHH | 53.26 | 23749301 | |
172 | Ubiquitination | EQDAILLKKHIS--- HHHHHEEHHCCC--- | 38.57 | 23749301 | |
172 | Acetylation | EQDAILLKKHIS--- HHHHHEEHHCCC--- | 38.57 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NAT5_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NAT5_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NAT5_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ARD1_YEAST | ARD1 | physical | 14517307 | |
NAT1_YEAST | NAT1 | physical | 14517307 | |
PALF_YEAST | RIM8 | physical | 16554755 | |
SSB1_YEAST | SSB1 | physical | 19536198 | |
RL3_YEAST | RPL3 | physical | 17541948 | |
RS3_YEAST | RPS3 | physical | 17541948 | |
RL21B_YEAST | RPL21B | genetic | 27708008 | |
AIM44_YEAST | AIM44 | genetic | 27708008 | |
YP022_YEAST | YPR022C | genetic | 27708008 | |
CTF4_YEAST | CTF4 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...