UniProt ID | RCM1_YEAST | |
---|---|---|
UniProt AC | P53972 | |
Protein Name | 25S rRNA (cytosine(2278)-C(5))-methyltransferase | |
Gene Name | RCM1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 490 | |
Subcellular Localization | Nucleus, nucleolus . | |
Protein Description | S-adenosyl-L-methionine-dependent methyltransferase that specifically methylates the C(5) position of cytosine 2278 (m5C2278) in 25S rRNA. Loss of m5C2278 in 25S rRNA results in anisomycin hypersensitivity.. | |
Protein Sequence | MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPYLEKVMKKAHILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSPLHSEMVKLKLKLKVRELSELVLSEDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKFTLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNRRKIDDKDDDGGIVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLLLDKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSDGGIGFFAVCFERD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
138 | Phosphorylation | KLKVRELSELVLSED HHHHHHHHHHHHCCC | 30377154 | ||
143 | Phosphorylation | ELSELVLSEDISNDL HHHHHHHCCCCCCCC | 30377154 | ||
181 | Phosphorylation | AELRKKFTLKVDKWS HHHHHHCCEEECCHH | 27017623 | ||
220 | Acetylation | ITAHELYKHGKIIIQ CCHHHHHHCCCEEEE | 22865919 | ||
281 | Acetylation | TRIYAFEKDPERAKV CEEEEEECCHHHHHH | 24489116 | ||
343 | Phosphorylation | FGRKFFDSFNRRKID CCHHHHHCCCCCCCC | 30377154 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RCM1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RCM1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RCM1_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RT05_YEAST | MRPS5 | physical | 16554755 | |
MED9_YEAST | CSE2 | genetic | 19061648 | |
DUS2_YEAST | SMM1 | genetic | 19061648 | |
MPP6_YEAST | MPP6 | genetic | 19061648 | |
MRT4_YEAST | MRT4 | genetic | 19061648 | |
UAF30_YEAST | UAF30 | genetic | 19061648 | |
RS8A_YEAST | RPS8A | genetic | 27708008 | |
RS8B_YEAST | RPS8A | genetic | 27708008 | |
UME6_YEAST | UME6 | genetic | 27708008 | |
HMI1_YEAST | HMI1 | genetic | 27708008 | |
SRL4_YEAST | SRL4 | genetic | 27708008 | |
PMA2_YEAST | PMA2 | genetic | 27708008 | |
MDL2_YEAST | MDL2 | genetic | 27708008 | |
BRR1_YEAST | BRR1 | genetic | 27708008 | |
MED1_YEAST | MED1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...