| UniProt ID | SAY1_YEAST | |
|---|---|---|
| UniProt AC | P53324 | |
| Protein Name | Steryl acetyl hydrolase 1 | |
| Gene Name | SAY1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 424 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type II membrane protein . |
|
| Protein Description | Required for the deacetylation of acetylated sterols. Involved in the resistance to eugenol and pregnenolone toxicity.. | |
| Protein Sequence | MAANSGLDSKVEYYRLQENEIISAVSSEDADQNDAGFRLSTIHLHLFHGLKFAALLFTVVPVFIILDSMKIIFQRKRRFCLDHVNRSFLRQSSWILDERICQYVLNPLFVCLYPSTFSSPTYVKCNIPIEDQKSPENNIFQDHQLNAPKIVSTKFYQYVMPEGFDPTTDPVLVFYHGGGYALKLTPTSFSFLNNMRNAFPKMAILVPDYTVTATDDQSKKYPLQILQNVAIFDYVVKTMGCKNVVIMGDSAGGNAVLNIVLYLRKCHREIYPKKVIAISPWANATFFHEGEKEYMQGTQEWDGLCLKSHSMFGRMFVGNNPNVDFTSDPFVNIEKNFETKMWQDILKKCSVMITYGSDELLSFQNKILAKKMSDASEGCNHFTAKNVLVEHQGYHTGPILNYSRNMDRWTNIPSIARILEFMQS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAANSGLDS ------CCCCCCCCC | 18.49 | 22814378 | |
| 10 | Ubiquitination | ANSGLDSKVEYYRLQ CCCCCCCCCEEEECC | 38.46 | 24961812 | |
| 85 | N-linked_Glycosylation | RFCLDHVNRSFLRQS HHHHHHHCHHHHHHH | 30.38 | - | |
| 283 | N-linked_Glycosylation | IAISPWANATFFHEG EEECCCCCCCEECCC | 35.33 | - | |
| 401 | N-linked_Glycosylation | YHTGPILNYSRNMDR CCCCCCCCCCCCCCC | 33.19 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SAY1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SAY1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SAY1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...