| UniProt ID | ARL3_YEAST | |
|---|---|---|
| UniProt AC | Q02804 | |
| Protein Name | ADP-ribosylation factor-like protein 3 | |
| Gene Name | ARL3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 198 | |
| Subcellular Localization | Golgi apparatus. | |
| Protein Description | Involved in the targeting of ARL1 to the Golgi. Can bind and hydrolyze GTP.. | |
| Protein Sequence | MFHLVKGLYNNWNKKEQYSILILGLDNAGKTTFLETLKKEYSLAFKALEKIQPTVGQNVATIPVDSKQILKFWDVGGQESLRSMWSEYYSLCHGIIFIVDSSDRERLDECSTTLQSVVMDEEIEGVPILMLANKQDRQDRMEVQDIKEVFNKIAEHISARDSRVLPISALTGEGVKDAIEWMIVRLERNKKSRPPIYK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MFHLVKGL -------CCCCHHCH | 4.27 | 15077114 | |
| 46 | Ubiquitination | KEYSLAFKALEKIQP HHHHHHHHHHHHHCC | 46.59 | 22817900 | |
| 50 | Ubiquitination | LAFKALEKIQPTVGQ HHHHHHHHHCCCCCC | 47.71 | 23749301 | |
| 67 | Acetylation | ATIPVDSKQILKFWD EEEECCHHHHHHHEE | 36.57 | 24489116 | |
| 152 | Ubiquitination | DIKEVFNKIAEHISA HHHHHHHHHHHHHHH | 31.65 | 24961812 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARL3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARL3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARL3_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Golgi targeting of ARF-like GTPase Arl3p requires its Nalpha-acetylation and the integral membrane protein Sys1p."; Setty S.R., Strochlic T.I., Tong A.H., Boone C., Burd C.G.; Nat. Cell Biol. 6:414-419(2004). Cited for: ACETYLATION AT MET-1, AND INTERACTION WITH SYS1. | |
| "Targeting of the Arf-like GTPase Arl3p to the Golgi requires N-terminal acetylation and the membrane protein Sys1p."; Behnia R., Panic B., Whyte J.R.C., Munro S.; Nat. Cell Biol. 6:405-413(2004). Cited for: ACETYLATION AT MET-1, AND INTERACTION WITH SYS1. | |
