GAT4_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GAT4_YEAST
• UniProt AC: P40569
• Protein Name: Protein GAT4
• Gene Name: GAT4
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 121
• Protein Sequence: MSTKLPIVISNGTAFKKVPVQLLLNSGSEAQHGLPRNADSQPARPRTGITRTCGQCGEIKTSLQWREGPNGAACLCNACGLFFRKLILRFGRAAAKRYMEQIKGTGTKRRIPKELTGTVRF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of GAT4_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GAT4_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GAT4_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GAT4_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ATG1_YEAST	ATG1	genetic	21127252
UPC2_YEAST	UPC2	genetic	21127252
APC11_YEAST	APC11	genetic	27708008
SNU56_YEAST	SNU56	genetic	27708008
RPB7_YEAST	RPB7	genetic	27708008
RSP5_YEAST	RSP5	genetic	27708008
ACT_YEAST	ACT1	genetic	27708008
PRP18_YEAST	PRP18	genetic	27708008
BRL1_YEAST	BRL1	genetic	27708008
CDC12_YEAST	CDC12	genetic	27708008
SEC22_YEAST	SEC22	genetic	27708008
TPT1_YEAST	TPT1	genetic	27708008
DYR_YEAST	DFR1	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.