UniProt ID | GAT4_YEAST | |
---|---|---|
UniProt AC | P40569 | |
Protein Name | Protein GAT4 | |
Gene Name | GAT4 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 121 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSTKLPIVISNGTAFKKVPVQLLLNSGSEAQHGLPRNADSQPARPRTGITRTCGQCGEIKTSLQWREGPNGAACLCNACGLFFRKLILRFGRAAAKRYMEQIKGTGTKRRIPKELTGTVRF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of GAT4_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GAT4_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GAT4_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GAT4_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ATG1_YEAST | ATG1 | genetic | 21127252 | |
UPC2_YEAST | UPC2 | genetic | 21127252 | |
APC11_YEAST | APC11 | genetic | 27708008 | |
SNU56_YEAST | SNU56 | genetic | 27708008 | |
RPB7_YEAST | RPB7 | genetic | 27708008 | |
RSP5_YEAST | RSP5 | genetic | 27708008 | |
ACT_YEAST | ACT1 | genetic | 27708008 | |
PRP18_YEAST | PRP18 | genetic | 27708008 | |
BRL1_YEAST | BRL1 | genetic | 27708008 | |
CDC12_YEAST | CDC12 | genetic | 27708008 | |
SEC22_YEAST | SEC22 | genetic | 27708008 | |
TPT1_YEAST | TPT1 | genetic | 27708008 | |
DYR_YEAST | DFR1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...