UniProt ID | PRP18_YEAST | |
---|---|---|
UniProt AC | P33411 | |
Protein Name | Pre-mRNA-splicing factor 18 | |
Gene Name | PRP18 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 251 | |
Subcellular Localization | Nucleus. | |
Protein Description | Component of the U4/U5/U6 snRNP, binding principally to the u5 snRNP. It is not absolutely required for the second step of pre-mRNA splicing at low temperatures but is required at higher temperatures. It may stabilize a particular conformation of the U5 snRNP or orient the U5 snRNP within the U4/U5/U6 snRNP or within the spliceosome.. | |
Protein Sequence | MDLDLASILKGEISKKKKELANSKGVQPPCTEKFQPHESANIDETPRQVEQESTDEENLSDNQSDDIRTTISKLENRPERIQEAIAQDKTISVIIDPSQIGSTEGKPLLSMKCNLYIHEILSRWKASLEAYHPELFLDTKKALFPLLLQLRRNQLAPDLLISLATVLYHLQQPKEINLAVQSYMKLSIGNVAWPIGVTSVGIHARSAHSKIQGGRNAANIMIDERTRLWITSIKRLITFEEWYTSNHDSLA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Phosphorylation | -MDLDLASILKGEIS -CCCHHHHHHHHHHH | 35.43 | 26447709 | |
39 | Phosphorylation | EKFQPHESANIDETP CCCCCCCCCCCCCCC | 24.47 | 21551504 | |
45 | Phosphorylation | ESANIDETPRQVEQE CCCCCCCCCCHHHHC | 21.74 | 21551504 | |
53 | Phosphorylation | PRQVEQESTDEENLS CCHHHHCCCCCCCCC | 40.63 | 21440633 | |
54 | Phosphorylation | RQVEQESTDEENLSD CHHHHCCCCCCCCCC | 46.83 | 21440633 | |
60 | Phosphorylation | STDEENLSDNQSDDI CCCCCCCCCCCCHHH | 46.20 | 21440633 | |
64 | Phosphorylation | ENLSDNQSDDIRTTI CCCCCCCCHHHHHHH | 43.43 | 23749301 | |
69 | Phosphorylation | NQSDDIRTTISKLEN CCCHHHHHHHHHHHC | 28.90 | 24961812 | |
70 | Phosphorylation | QSDDIRTTISKLENR CCHHHHHHHHHHHCC | 17.26 | 21551504 | |
72 | Phosphorylation | DDIRTTISKLENRPE HHHHHHHHHHHCCHH | 29.15 | 24961812 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRP18_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRP18_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRP18_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...