| UniProt ID | PRP18_YEAST | |
|---|---|---|
| UniProt AC | P33411 | |
| Protein Name | Pre-mRNA-splicing factor 18 | |
| Gene Name | PRP18 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 251 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Component of the U4/U5/U6 snRNP, binding principally to the u5 snRNP. It is not absolutely required for the second step of pre-mRNA splicing at low temperatures but is required at higher temperatures. It may stabilize a particular conformation of the U5 snRNP or orient the U5 snRNP within the U4/U5/U6 snRNP or within the spliceosome.. | |
| Protein Sequence | MDLDLASILKGEISKKKKELANSKGVQPPCTEKFQPHESANIDETPRQVEQESTDEENLSDNQSDDIRTTISKLENRPERIQEAIAQDKTISVIIDPSQIGSTEGKPLLSMKCNLYIHEILSRWKASLEAYHPELFLDTKKALFPLLLQLRRNQLAPDLLISLATVLYHLQQPKEINLAVQSYMKLSIGNVAWPIGVTSVGIHARSAHSKIQGGRNAANIMIDERTRLWITSIKRLITFEEWYTSNHDSLA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Phosphorylation | -MDLDLASILKGEIS -CCCHHHHHHHHHHH | 35.43 | 26447709 | |
| 39 | Phosphorylation | EKFQPHESANIDETP CCCCCCCCCCCCCCC | 24.47 | 21551504 | |
| 45 | Phosphorylation | ESANIDETPRQVEQE CCCCCCCCCCHHHHC | 21.74 | 21551504 | |
| 53 | Phosphorylation | PRQVEQESTDEENLS CCHHHHCCCCCCCCC | 40.63 | 21440633 | |
| 54 | Phosphorylation | RQVEQESTDEENLSD CHHHHCCCCCCCCCC | 46.83 | 21440633 | |
| 60 | Phosphorylation | STDEENLSDNQSDDI CCCCCCCCCCCCHHH | 46.20 | 21440633 | |
| 64 | Phosphorylation | ENLSDNQSDDIRTTI CCCCCCCCHHHHHHH | 43.43 | 23749301 | |
| 69 | Phosphorylation | NQSDDIRTTISKLEN CCCHHHHHHHHHHHC | 28.90 | 24961812 | |
| 70 | Phosphorylation | QSDDIRTTISKLENR CCHHHHHHHHHHHCC | 17.26 | 21551504 | |
| 72 | Phosphorylation | DDIRTTISKLENRPE HHHHHHHHHHHCCHH | 29.15 | 24961812 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRP18_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRP18_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRP18_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
