| UniProt ID | NSL1_YEAST | |
|---|---|---|
| UniProt AC | Q12143 | |
| Protein Name | Kinetochore-associated protein NSL1 | |
| Gene Name | NSL1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 216 | |
| Subcellular Localization | Nucleus . Chromosome, centromere, kinetochore . Associated with the kinetochore (PubMed:12455957, PubMed:14657030). | |
| Protein Description | Acts as essential component of the kinetochore MIND complex, which is required for the spindle checkpoint and kinetochore integrity. MIND plays a role in establishing a bipolar spindle-kinetochore interaction by joining kinetochore subunits contacting DNA to those contacting microtubules. NSL1 facilitates the attachment of two of the DASH complex components, DAD2 and SPC19, to the kinetochore in a microtubule-dependent manner.. | |
| Protein Sequence | MSQGQSKKLDVTVEQLRSIYHQFHDILEEKTDLHLPKKEYDDDAVRREVQIQLQEFLLSAMTMASKSLEVVNADTVGKTVKQLIMESQEKYMEPFDLDLNEQVRKMYQEWEDETVKVAQLRQTGPAKINEVYNNSKDEYLAQLDGRIGVLQARMMQQQSADHDDSTDDADDHINWEHIKQDYVASLNELYQTQQDLPKVRYNVEKVKRLMDFLEED | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSQGQSKKL ------CCCCCCCCC | 42.91 | 22814378 | |
| 40 | Phosphorylation | LHLPKKEYDDDAVRR CCCCCHHCCCHHHHH | 33.29 | 28889911 | |
| 114 | Phosphorylation | YQEWEDETVKVAQLR HHHHCCCHHHHHHHH | 37.64 | 28889911 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NSL1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NSL1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
