UniProt ID | NSL1_YEAST | |
---|---|---|
UniProt AC | Q12143 | |
Protein Name | Kinetochore-associated protein NSL1 | |
Gene Name | NSL1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 216 | |
Subcellular Localization | Nucleus . Chromosome, centromere, kinetochore . Associated with the kinetochore (PubMed:12455957, PubMed:14657030). | |
Protein Description | Acts as essential component of the kinetochore MIND complex, which is required for the spindle checkpoint and kinetochore integrity. MIND plays a role in establishing a bipolar spindle-kinetochore interaction by joining kinetochore subunits contacting DNA to those contacting microtubules. NSL1 facilitates the attachment of two of the DASH complex components, DAD2 and SPC19, to the kinetochore in a microtubule-dependent manner.. | |
Protein Sequence | MSQGQSKKLDVTVEQLRSIYHQFHDILEEKTDLHLPKKEYDDDAVRREVQIQLQEFLLSAMTMASKSLEVVNADTVGKTVKQLIMESQEKYMEPFDLDLNEQVRKMYQEWEDETVKVAQLRQTGPAKINEVYNNSKDEYLAQLDGRIGVLQARMMQQQSADHDDSTDDADDHINWEHIKQDYVASLNELYQTQQDLPKVRYNVEKVKRLMDFLEED | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSQGQSKKL ------CCCCCCCCC | 42.91 | 22814378 | |
40 | Phosphorylation | LHLPKKEYDDDAVRR CCCCCHHCCCHHHHH | 33.29 | 28889911 | |
114 | Phosphorylation | YQEWEDETVKVAQLR HHHHCCCHHHHHHHH | 37.64 | 28889911 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NSL1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NSL1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...