| UniProt ID | RME1_YEAST | |
|---|---|---|
| UniProt AC | P32338 | |
| Protein Name | Zinc finger protein RME1 | |
| Gene Name | RME1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 300 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Involved in the control of meiosis. Represses the transcription of the IME1 gene thereby inhibiting cells from entering meiosis. But also activates the CLN2 gene thus promoting mitosis.. | |
| Protein Sequence | MSPCYGQNSAIAKGSWNREVLQEVQPIYHWHDFGQNMKEYSASPLEGDSSLPSSLPSSTEDCLLLSLENTITVIAGNQRQAYDSTSSTEEGTAPQLRPDEIADSTHCITSLVDPEFRDLINYGRQKGANPVFIESNTTEQSHSQCILGYPQKSHVAQLYHDPKVLSTISEGQTKRGSYHCSHCSEKFATLVEFAAHLDEFNLERPCKCPIEQCPWKILGFQQATGLRRHCASQHIGELDIEMEKSLNLKVEKYPGLNCPFPICQKTFRRKDAYKRHVAMVHNNADSRFNKRLKKILNNTK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSPCYGQNS ------CCCCCCCCC | 24.55 | 22369663 | |
| 174 | Ubiquitination | TISEGQTKRGSYHCS ECCCCCCCCCCEECC | 47.04 | 23749301 | |
| 186 | Ubiquitination | HCSHCSEKFATLVEF ECCHHHHHHHHHHHH | 24.81 | 17644757 | |
| 207 | Ubiquitination | FNLERPCKCPIEQCP CCCCCCCCCCHHHCC | 45.81 | 17644757 | |
| 216 | Ubiquitination | PIEQCPWKILGFQQA CHHHCCCCCCCHHHH | 17.13 | 17644757 | |
| 252 | Ubiquitination | SLNLKVEKYPGLNCP HHCCCEEECCCCCCC | 60.78 | 17644757 | |
| 265 | Ubiquitination | CPFPICQKTFRRKDA CCCCHHHHHHCCCHH | 45.26 | 17644757 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RME1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RME1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RME1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
