UniProt ID | YL036_YEAST | |
---|---|---|
UniProt AC | Q07986 | |
Protein Name | Uncharacterized protein YLR036C | |
Gene Name | YLR036C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 203 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MKEAELSATESQDEIPKSNSLLIIEKLTKAVCSLYFINCFMVPSVDNLIEKYPKAIIIKIIDMILGAVTISLVIIVFFLYRKNGHFKNENKTKPKRCSKVVCPSCAARKKYPKWFQLKYLLLVSMTAFSFYFCTKIRFFFKTDQTINLHRLSQLFRLQLGWICTTALLFYFYDALILHSGFIEGYRCVNGKGAMSEGKTGQLN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Ubiquitination | ------MKEAELSAT ------CCHHHHCCC | 66.68 | 23749301 | |
99 | Ubiquitination | TKPKRCSKVVCPSCA CCCCCCCCEECCHHH | 42.17 | 23749301 | |
191 | Ubiquitination | GYRCVNGKGAMSEGK CEEEECCCCCCCCCC | 37.99 | 23749301 | |
198 | Ubiquitination | KGAMSEGKTGQLN-- CCCCCCCCCCCCC-- | 45.49 | 23749301 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YL036_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YL036_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YL036_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PEX29_YEAST | PEX29 | physical | 18719252 | |
INO2_YEAST | INO2 | genetic | 27708008 | |
YJY1_YEAST | YJR011C | genetic | 27708008 | |
CSN12_YEAST | YJR084W | genetic | 27708008 | |
HIR3_YEAST | HIR3 | genetic | 27708008 | |
MRT4_YEAST | MRT4 | genetic | 27708008 | |
TOF2_YEAST | TOF2 | genetic | 27708008 | |
TOP3_YEAST | TOP3 | genetic | 27708008 | |
PML39_YEAST | PML39 | genetic | 27708008 | |
SAP30_YEAST | SAP30 | genetic | 27708008 | |
SIN3_YEAST | SIN3 | genetic | 27708008 | |
FYV12_YEAST | FYV12 | genetic | 27708008 | |
HAP5_YEAST | HAP5 | genetic | 27708008 | |
YP109_YEAST | YPL109C | genetic | 27708008 | |
CTSR1_HUMAN | CATSPER1 | physical | 27107014 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...