| UniProt ID | YL036_YEAST | |
|---|---|---|
| UniProt AC | Q07986 | |
| Protein Name | Uncharacterized protein YLR036C | |
| Gene Name | YLR036C | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 203 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MKEAELSATESQDEIPKSNSLLIIEKLTKAVCSLYFINCFMVPSVDNLIEKYPKAIIIKIIDMILGAVTISLVIIVFFLYRKNGHFKNENKTKPKRCSKVVCPSCAARKKYPKWFQLKYLLLVSMTAFSFYFCTKIRFFFKTDQTINLHRLSQLFRLQLGWICTTALLFYFYDALILHSGFIEGYRCVNGKGAMSEGKTGQLN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Ubiquitination | ------MKEAELSAT ------CCHHHHCCC | 66.68 | 23749301 | |
| 99 | Ubiquitination | TKPKRCSKVVCPSCA CCCCCCCCEECCHHH | 42.17 | 23749301 | |
| 191 | Ubiquitination | GYRCVNGKGAMSEGK CEEEECCCCCCCCCC | 37.99 | 23749301 | |
| 198 | Ubiquitination | KGAMSEGKTGQLN-- CCCCCCCCCCCCC-- | 45.49 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YL036_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YL036_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YL036_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PEX29_YEAST | PEX29 | physical | 18719252 | |
| INO2_YEAST | INO2 | genetic | 27708008 | |
| YJY1_YEAST | YJR011C | genetic | 27708008 | |
| CSN12_YEAST | YJR084W | genetic | 27708008 | |
| HIR3_YEAST | HIR3 | genetic | 27708008 | |
| MRT4_YEAST | MRT4 | genetic | 27708008 | |
| TOF2_YEAST | TOF2 | genetic | 27708008 | |
| TOP3_YEAST | TOP3 | genetic | 27708008 | |
| PML39_YEAST | PML39 | genetic | 27708008 | |
| SAP30_YEAST | SAP30 | genetic | 27708008 | |
| SIN3_YEAST | SIN3 | genetic | 27708008 | |
| FYV12_YEAST | FYV12 | genetic | 27708008 | |
| HAP5_YEAST | HAP5 | genetic | 27708008 | |
| YP109_YEAST | YPL109C | genetic | 27708008 | |
| CTSR1_HUMAN | CATSPER1 | physical | 27107014 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...