UniProt ID | FYV12_YEAST | |
---|---|---|
UniProt AC | Q08559 | |
Protein Name | Protein FYV12 | |
Gene Name | FYV12 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 129 | |
Subcellular Localization |
Membrane Single-pass membrane protein . |
|
Protein Description | Involved in K1 killer toxin resistance.. | |
Protein Sequence | MRLLHHGEYGTKLIGGKCSIDGKLGHPCPLSRRRKKHLREKEMGPQYVRMYGPKRKAIIRTGNPDDGINLPDTGRGTLTAATIWSRAYHSNYSYLVRPKVVTLSKHRELMTTFLLYVLYVCIYISAFIK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FYV12_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FYV12_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FYV12_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
LSM2_YEAST | LSM2 | genetic | 27708008 | |
EIF3A_YEAST | RPG1 | genetic | 27708008 | |
NOT1_YEAST | CDC39 | genetic | 27708008 | |
PRP9_YEAST | PRP9 | genetic | 27708008 | |
SAD1_YEAST | SAD1 | genetic | 27708008 | |
PRP43_YEAST | PRP43 | genetic | 27708008 | |
BBP_YEAST | MSL5 | genetic | 27708008 | |
CLF1_YEAST | CLF1 | genetic | 27708008 | |
RU1C_YEAST | YHC1 | genetic | 27708008 | |
MET8_YEAST | MET8 | genetic | 27708008 | |
LSM6_YEAST | LSM6 | genetic | 27708008 | |
MUD2_YEAST | MUD2 | genetic | 27708008 | |
HBS1_YEAST | HBS1 | genetic | 27708008 | |
RS30A_YEAST | RPS30A | genetic | 27708008 | |
RS30B_YEAST | RPS30A | genetic | 27708008 | |
DOM34_YEAST | DOM34 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...