| UniProt ID | FYV12_YEAST | |
|---|---|---|
| UniProt AC | Q08559 | |
| Protein Name | Protein FYV12 | |
| Gene Name | FYV12 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 129 | |
| Subcellular Localization |
Membrane Single-pass membrane protein . |
|
| Protein Description | Involved in K1 killer toxin resistance.. | |
| Protein Sequence | MRLLHHGEYGTKLIGGKCSIDGKLGHPCPLSRRRKKHLREKEMGPQYVRMYGPKRKAIIRTGNPDDGINLPDTGRGTLTAATIWSRAYHSNYSYLVRPKVVTLSKHRELMTTFLLYVLYVCIYISAFIK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FYV12_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FYV12_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FYV12_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| LSM2_YEAST | LSM2 | genetic | 27708008 | |
| EIF3A_YEAST | RPG1 | genetic | 27708008 | |
| NOT1_YEAST | CDC39 | genetic | 27708008 | |
| PRP9_YEAST | PRP9 | genetic | 27708008 | |
| SAD1_YEAST | SAD1 | genetic | 27708008 | |
| PRP43_YEAST | PRP43 | genetic | 27708008 | |
| BBP_YEAST | MSL5 | genetic | 27708008 | |
| CLF1_YEAST | CLF1 | genetic | 27708008 | |
| RU1C_YEAST | YHC1 | genetic | 27708008 | |
| MET8_YEAST | MET8 | genetic | 27708008 | |
| LSM6_YEAST | LSM6 | genetic | 27708008 | |
| MUD2_YEAST | MUD2 | genetic | 27708008 | |
| HBS1_YEAST | HBS1 | genetic | 27708008 | |
| RS30A_YEAST | RPS30A | genetic | 27708008 | |
| RS30B_YEAST | RPS30A | genetic | 27708008 | |
| DOM34_YEAST | DOM34 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...