| UniProt ID | DOM34_YEAST | |
|---|---|---|
| UniProt AC | P33309 | |
| Protein Name | Protein DOM34 | |
| Gene Name | DOM34 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 386 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Involved in protein translation. Together with HBS1, may function in recognizing stalled ribosomes and triggering endonucleolytic cleavage of the mRNA, a mechanism to release non-functional ribosomes and degrade damaged mRNAs. The complex formed by DOM34 and HBS1 has ribonuclease activity towards double-stranded RNA substrates, but does not cleave single-stranded RNA. Acts as endonuclease; has no exonuclease activity. Increases the affinity of HBS1 for GTP, but nor for GDP. Promotes G1 progression and differentiation and is involved in mitotic and meiotic cell divisions.. | |
| Protein Sequence | MKVISLKKDSFNKGGAVITLLPEDKEDLFTVYQIVDKDDELIFKKKFTSKLDEAGKKKSTDLVKLKIKVISEDFDMKDEYLKYKGVTVTDESGASNVDIPVGKYLSFTLDYVYPFTIIKQNFNKFMQKLLNEACNIEYKSDTAAVVLQEGIAHVCLVTSSSTILKQKIEYSMPKKKRTTDVLKFDEKTEKFYKAIYSAMKKDLNFDKLKTIILCSPGFYAKILMDKIFQYAEEEHNKKILDNKGMFFIAHCSTGYLQGINEVLKNPLYASKLQDTKYSKEIMVMDEFLLHLNKDDDKAWYGEKEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSLGEELDQLTGIACILKYPLPDLDEDDGEE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 50 | Acetylation | FKKKFTSKLDEAGKK EEHHHHHHCHHCCCC | 57.83 | 25381059 | |
| 77 | Acetylation | ISEDFDMKDEYLKYK ECCCCCCCCHHHCCC | 49.61 | 24489116 | |
| 82 | Acetylation | DMKDEYLKYKGVTVT CCCCHHHCCCCEEEE | 43.97 | 24489116 | |
| 174 | Acetylation | KIEYSMPKKKRTTDV HHHCCCCCCCCCCCC | 63.39 | 25381059 | |
| 183 | Acetylation | KRTTDVLKFDEKTEK CCCCCCCCCCHHHHH | 51.09 | 24489116 | |
| 187 | Acetylation | DVLKFDEKTEKFYKA CCCCCCHHHHHHHHH | 64.92 | 24489116 | |
| 188 | Phosphorylation | VLKFDEKTEKFYKAI CCCCCHHHHHHHHHH | 42.22 | 19795423 | |
| 192 | Phosphorylation | DEKTEKFYKAIYSAM CHHHHHHHHHHHHHH | 15.58 | 19795423 | |
| 207 | Acetylation | KKDLNFDKLKTIILC HCCCCHHHCCEEEEE | 47.98 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DOM34_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DOM34_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DOM34_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
