UniProt ID | RL23B_YEAST | |
---|---|---|
UniProt AC | P0CX42 | |
Protein Name | 60S ribosomal protein L23-B {ECO:0000303|PubMed:9559554} | |
Gene Name | RPL23B {ECO:0000303|PubMed:9559554} | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 137 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel.. | |
Protein Sequence | MSGNGAQGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPAASLGDMVMATVKKGKPELRKKVMPAIVVRQAKSWRRRDGVFLYFEDNAGVIANPKGEMKGSAITGPVGKECADLWPRVASNSGVVV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSGNGAQGT ------CCCCCCCCC | 40.75 | 22814378 | |
14 | Phosphorylation | QGTKFRISLGLPVGA CCCCEEEEECCCHHH | 16.48 | 21440633 | |
35 | Phosphorylation | NSGARNLYIIAVKGS CCCCCCEEEEEEECC | 8.20 | 21082442 | |
40 | Ubiquitination | NLYIIAVKGSGSRLN CEEEEEEECCCCHHC | 38.03 | 22817900 | |
42 | Phosphorylation | YIIAVKGSGSRLNRL EEEEEECCCCHHCCC | 28.07 | 22369663 | |
44 | Phosphorylation | IAVKGSGSRLNRLPA EEEECCCCHHCCCCC | 34.98 | 22369663 | |
53 | Phosphorylation | LNRLPAASLGDMVMA HCCCCCCHHHHHHHH | 34.68 | 21440633 | |
61 | Phosphorylation | LGDMVMATVKKGKPE HHHHHHHHHHCCCHH | 18.11 | 22369663 | |
63 | Ubiquitination | DMVMATVKKGKPELR HHHHHHHHCCCHHHH | 51.99 | 17644757 | |
64 | Ubiquitination | MVMATVKKGKPELRK HHHHHHHCCCHHHHH | 68.76 | 17644757 | |
106 | "N6,N6-dimethyllysine" | AGVIANPKGEMKGSA CEEEECCCCCCCCCE | 68.27 | - | |
106 | Methylation | AGVIANPKGEMKGSA CEEEECCCCCCCCCE | 68.27 | 17327221 | |
110 | Methylation | ANPKGEMKGSAITGP ECCCCCCCCCEEECC | 45.47 | 17327221 | |
110 | Ubiquitination | ANPKGEMKGSAITGP ECCCCCCCCCEEECC | 45.47 | 23749301 | |
110 | "N6,N6-dimethyllysine" | ANPKGEMKGSAITGP ECCCCCCCCCEEECC | 45.47 | - | |
112 | Phosphorylation | PKGEMKGSAITGPVG CCCCCCCCEEECCCC | 15.81 | 17287358 | |
131 | Phosphorylation | DLWPRVASNSGVVV- HHCHHHHCCCCCCC- | 28.77 | 21440633 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL23B_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL23B_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"A novel SET domain methyltransferase modifies ribosomal proteinRpl23ab in yeast."; Porras-Yakushi T.R., Whitelegge J.P., Miranda T.B., Clarke S.; J. Biol. Chem. 280:34590-34598(2005). Cited for: ACETYLATION AT SER-2, AND METHYLATION AT LYS-40; LYS-106 AND LYS-110. | |
Phosphorylation | |
Reference | PubMed |
"Analysis of phosphorylation sites on proteins from Saccharomycescerevisiae by electron transfer dissociation (ETD) massspectrometry."; Chi A., Huttenhower C., Geer L.Y., Coon J.J., Syka J.E.P., Bai D.L.,Shabanowitz J., Burke D.J., Troyanskaya O.G., Hunt D.F.; Proc. Natl. Acad. Sci. U.S.A. 104:2193-2198(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-112, AND MASSSPECTROMETRY. |