| UniProt ID | KCY_YEAST | |
|---|---|---|
| UniProt AC | P15700 | |
| Protein Name | Uridylate kinase {ECO:0000255|HAMAP-Rule:MF_03172} | |
| Gene Name | URA6 {ECO:0000255|HAMAP-Rule:MF_03172} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 204 | |
| Subcellular Localization | Cytoplasm . Nucleus . Predominantly cytoplasmic. | |
| Protein Description | Catalyzes the phosphorylation of pyrimidine nucleoside monophosphates at the expense of ATP. Plays an important role in de novo pyrimidine nucleotide biosynthesis. Has preference for UMP and dUMP as phosphate acceptors, but can also use CMP, dCMP, AMP, GMP, dGMP and dTMP. ATP and dATP are the best phosphate donors, but can also use GTP, dGTP, dCTP, and dTTP to some degree.. | |
| Protein Sequence | MTAATTSQPAFSPDQVSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGELIKNCIKEGQIVPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERDIVESKFILFFDCPEDIMLERLLERGKTSGRSDDNIESIKKRFNTFKETSMPVIEYFETKSKVVRVRCDRSVEDVYKDVQDAIRDSL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 35 | Acetylation | GKGTQCEKLVKDYSF CCCCHHHHHHCCCCE | 25381059 | ||
| 38 | Acetylation | TQCEKLVKDYSFVHL CHHHHHHCCCCEEEE | 24489116 | ||
| 40 | Phosphorylation | CEKLVKDYSFVHLSA HHHHHCCCCEEEECH | 19779198 | ||
| 41 | Phosphorylation | EKLVKDYSFVHLSAG HHHHCCCCEEEECHH | 22369663 | ||
| 67 | Acetylation | SQYGELIKNCIKEGQ HHHHHHHHHHHHCCC | 24489116 | ||
| 67 | Ubiquitination | SQYGELIKNCIKEGQ HHHHHHHHHHHHCCC | 23749301 | ||
| 71 | Ubiquitination | ELIKNCIKEGQIVPQ HHHHHHHHCCCCCCH | 22817900 | ||
| 99 | Acetylation | NVKANKHKFLIDGFP CCCCCCCCEEECCCC | 24489116 | ||
| 155 | Phosphorylation | RSDDNIESIKKRFNT CCCCCHHHHHHHHHH | 27017623 | ||
| 177 | Acetylation | VIEYFETKSKVVRVR EEEEEECCCCEEEEE | 24489116 | ||
| 194 | Acetylation | RSVEDVYKDVQDAIR CCHHHHHHHHHHHHH | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KCY_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KCY_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KCY_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
