GPI12_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GPI12_YEAST
• UniProt AC: P23797
• Protein Name: N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase
• Gene Name: GPI12
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 304
• Subcellular Localization: Endoplasmic reticulum membrane.
• Protein Description: Involved in the second step of GPI biosynthesis. De-N-acetylation of N-acetylglucosaminyl-phosphatidylinositol..
• Protein Sequence: MKMLRRTKVNFSKLLYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGDYEINLVIAHPDDEVMFFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHNERAVSVQVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCYAAVKKLVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRIIQALPPNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFDVYTY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
205	Phosphorylation	NEQPPHVTALYLRSY CCCCCCEEEEEEECC	14.12	28889911
211	Phosphorylation	VTALYLRSYKNNIVL EEEEEEECCCCCEEE	37.55	28889911
212	Phosphorylation	TALYLRSYKNNIVLK EEEEEECCCCCEEEE	15.99	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GPI12_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GPI12_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GPI12_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ATC1_YEAST	PMR1	genetic	23891562
GUP1_YEAST	GUP1	genetic	23891562
PLMT_YEAST	OPI3	genetic	23891562

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.