| UniProt ID | GPI11_YEAST | |
|---|---|---|
| UniProt AC | Q06636 | |
| Protein Name | Glycosylphosphatidylinositol anchor biosynthesis protein 11 | |
| Gene Name | GPI11 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 219 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
| Protein Description | Acts in the GPI biosynthetic pathway between GlcNAc-PI synthesis and GPI transfer to protein. Required for the formation of complete GPI precursors CP1 and CP2.. | |
| Protein Sequence | MPAKKRTRKTVKKTVSFSDDTTLTTHQNREKKNVDHDRPPVYVRKTPLMTFPYHLVALLYYYVFVSSNFNTVKLLSFLIPTQVAYLVLQFNKCTVYGNKIIKINYSLTIICLGVTFLLSFPTMLLTILFGAPLMDLLWETWLLSLHFAFLAYPAVYSVFNCDFKVGLWKKYFIFIVVGGWISCVVIPLDWDRDWQNWPIPIVVGGYLGALVGYTIGAYI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 14 | Phosphorylation | TRKTVKKTVSFSDDT CCCCEEEEEECCCCC | 18.70 | 22890988 | |
| 16 | Phosphorylation | KTVKKTVSFSDDTTL CCEEEEEECCCCCCE | 25.02 | 22369663 | |
| 18 | Phosphorylation | VKKTVSFSDDTTLTT EEEEEECCCCCCEEC | 27.37 | 22890988 | |
| 21 | Phosphorylation | TVSFSDDTTLTTHQN EEECCCCCCEECCCC | 28.79 | 22890988 | |
| 22 | Phosphorylation | VSFSDDTTLTTHQNR EECCCCCCEECCCCH | 29.15 | 29688323 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GPI11_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GPI11_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GPI11_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-16, AND MASSSPECTROMETRY. | |
