dbPTM

YGZ2_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YGZ2_YEAST
UniProt AC	P53066
Protein Name	Ankyrin repeat-containing protein YGL242C
Gene Name	YGL242C
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	181
Subcellular Localization
Protein Description
Protein Sequence	MNTEGASLSEQLLDAARRNNLDLLETVFDSLDNDPEKIAKLINESKEPLGNTALHLCCKYGSWEVLDKILDQDGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRNYNNQKPVDLVHGDELDELIDLLQGAELAIDSTNGSGDNNEDGEMIDDGPSDDDEEDDKK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MNTEGASL -------CCCCCCCH	14.63	22814378
153	Phosphorylation	GAELAIDSTNGSGDN CCCEEEECCCCCCCC	20.05	19823750
154	Phosphorylation	AELAIDSTNGSGDNN CCEEEECCCCCCCCC	39.59	19823750
157	Phosphorylation	AIDSTNGSGDNNEDG EEECCCCCCCCCCCC	45.07	19823750
172	Phosphorylation	EMIDDGPSDDDEEDD CCCCCCCCCCCCHHC	60.23	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YGZ2_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YGZ2_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YGZ2_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BAS1_YEAST	BAS1	physical	10688190
MYO5_YEAST	MYO5	physical	18467557
SRS2_YEAST	SRS2	genetic	21459050
YRA2_YEAST	YRA2	genetic	27708008
PSB6_YEAST	PRE7	genetic	27708008
CDC1_YEAST	CDC1	genetic	27708008
SNU56_YEAST	SNU56	genetic	27708008
MOB2_YEAST	MOB2	genetic	27708008
ACT_YEAST	ACT1	genetic	27708008
CDC11_YEAST	CDC11	genetic	27708008
NOP2_YEAST	NOP2	genetic	27708008
ARPC2_YEAST	ARC35	genetic	27708008
LAS17_YEAST	LAS17	genetic	27708008
SEO1_YEAST	SEO1	genetic	27708008
SLA1_YEAST	SLA1	genetic	27708008
RAD16_YEAST	RAD16	genetic	27708008
CWH43_YEAST	CWH43	genetic	27708008
MAK32_YEAST	MAK32	genetic	27708008
RIM1_YEAST	RIM1	genetic	27708008
ABP1_YEAST	ABP1	genetic	27708008
SAC7_YEAST	SAC7	genetic	27708008
CF130_YEAST	CAF130	genetic	27708008
STB5_YEAST	STB5	genetic	27708008
YIF5_YEAST	YIL055C	genetic	27708008
CSM2_YEAST	CSM2	genetic	27708008
RL16A_YEAST	RPL16A	genetic	27708008
POC2_YEAST	ADD66	genetic	27708008
SA190_YEAST	SAP190	genetic	27708008
RAX2_YEAST	RAX2	genetic	27708008
ALAM_YEAST	ALT1	genetic	27708008
ACE2_YEAST	ACE2	genetic	27708008
PCD1_YEAST	PCD1	genetic	27708008
GUF1_YEAST	GUF1	genetic	27708008
UBC12_YEAST	UBC12	genetic	27708008
BUD8_YEAST	BUD8	genetic	27708008
RS3A2_YEAST	RPS1B	genetic	27708008
GTR1_YEAST	GTR1	genetic	27708008
MYO5_YEAST	MYO5	genetic	27708008
PET8_YEAST	PET8	genetic	27708008
CTU2_YEAST	NCS2	genetic	27708008
MDY2_YEAST	MDY2	genetic	27708008
CY1_YEAST	CYT1	genetic	27708008
VAM3_YEAST	VAM3	genetic	27708008
FYV12_YEAST	FYV12	genetic	27708008
SSP2_YEAST	SSP2	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YGZ2_YEAST

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-172, AND MASSSPECTROMETRY.	18407956 [Abstract]