UniProt ID | POC2_YEAST | |
---|---|---|
UniProt AC | P36040 | |
Protein Name | Proteasome assembly chaperone 2 | |
Gene Name | ADD66 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 267 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Involved in 20S proteasome assembly. Required for maximal proteasome activity. Affects the chymotrypsin-like activity of the proteasome. Can be degraded by the proteasome. Involved in the endoplasmic reticulum-associated degradation (ERAD).. | |
Protein Sequence | MSCLVLPLVSVGNIPQLSIDWLLNSQANEWEYLEALDSKYLVEFVGPLDRPEDGSDSLYKDADMKYSSALEVFYNKKRGLFAIQQRTPLVSVNYLNNFIVEIILPFLSKYNISEICIWDSLYAMEDENGVIVRPQEVYSLGEFYFDDEAELLSNLHLNDQESMVNNWLHFTPTSFQDKISVDQPIFKILFQILNASQRPKALRSIKYCSCLANEGDNSLDSQQFLQWIISQKVIKNAPPIVKFVRPISWQGAYGMADARDKFVDLYN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
55 | Phosphorylation | LDRPEDGSDSLYKDA CCCCCCCCCCCHHCC | 36.03 | 21440633 | |
57 | Phosphorylation | RPEDGSDSLYKDADM CCCCCCCCCHHCCCC | 34.98 | 24961812 | |
66 | Phosphorylation | YKDADMKYSSALEVF HHCCCCCCHHHHHHH | 10.96 | 25005228 | |
248 | Phosphorylation | VKFVRPISWQGAYGM EEEEECCCCCCCCCC | 18.94 | 25752575 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of POC2_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of POC2_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of POC2_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...