YO13A_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YO13A_YEAST
• UniProt AC: P0C272
• Protein Name: Uncharacterized protein YOL013W-A
• Gene Name: YOL013W-A
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 63
• Protein Sequence: MMCIINSESFHGSQKRSGVWSSGMILALGDFLINRGTKHARGPGFNSQLAPFFTIEKYSVRRS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of YO13A_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YO13A_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YO13A_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YO13A_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PMP3_YEAST	PMP3	genetic	27708008
ATC1_YEAST	PMR1	genetic	27708008
ASK10_YEAST	ASK10	genetic	27708008
VPS51_YEAST	VPS51	genetic	27708008
MSC1_YEAST	MSC1	genetic	27708008
GBLP_YEAST	ASC1	genetic	27708008
SAP30_YEAST	SAP30	genetic	27708008
SSP2_YEAST	SSP2	genetic	27708008
ATPN_YEAST	ATP20	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.