UniProt ID | POC1_YEAST | |
---|---|---|
UniProt AC | Q05778 | |
Protein Name | Proteasome chaperone 1 | |
Gene Name | PBA1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 276 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Involved in 20S proteasome assembly.. | |
Protein Sequence | MLFKQWNDLPEPKHLLDLPEISKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNPLFPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADETVYGFSFPIYSFGKTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIASMKVMTENECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSDMGSLVDLCGQWLGFEPSRYSEECYRLWRCDSAAIGAQSGLYI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Ubiquitination | ----MLFKQWNDLPE ----CCCCCCCCCCC | 50.90 | 23749301 | |
13 | Acetylation | WNDLPEPKHLLDLPE CCCCCCCHHHHCHHH | 45.26 | 24489116 | |
79 | Phosphorylation | GEIKTTLTVKSPSLP CEEEEEEEEECCCCC | 24.64 | 21440633 | |
82 | Phosphorylation | KTTLTVKSPSLPQSS EEEEEEECCCCCCCC | 18.51 | 22369663 | |
84 | Phosphorylation | TLTVKSPSLPQSSGK EEEEECCCCCCCCCC | 60.83 | 23749301 | |
88 | Phosphorylation | KSPSLPQSSGKHSWN ECCCCCCCCCCCCCC | 38.83 | 22369663 | |
215 | Ubiquitination | PSKGLKFKCLVAPSE CCCCCEEEEEECCCC | 25.68 | 23749301 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of POC1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of POC1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of POC1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-82, AND MASSSPECTROMETRY. |