dbPTM

POC1_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	POC1_YEAST
UniProt AC	Q05778
Protein Name	Proteasome chaperone 1
Gene Name	PBA1
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	276
Subcellular Localization	Cytoplasm .
Protein Description	Involved in 20S proteasome assembly..
Protein Sequence	MLFKQWNDLPEPKHLLDLPEISKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNPLFPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADETVYGFSFPIYSFGKTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIASMKVMTENECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSDMGSLVDLCGQWLGFEPSRYSEECYRLWRCDSAAIGAQSGLYI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Ubiquitination	----MLFKQWNDLPE ----CCCCCCCCCCC	50.90	23749301
13	Acetylation	WNDLPEPKHLLDLPE CCCCCCCHHHHCHHH	45.26	24489116
79	Phosphorylation	GEIKTTLTVKSPSLP CEEEEEEEEECCCCC	24.64	21440633
82	Phosphorylation	KTTLTVKSPSLPQSS EEEEEEECCCCCCCC	18.51	22369663
84	Phosphorylation	TLTVKSPSLPQSSGK EEEEECCCCCCCCCC	60.83	23749301
88	Phosphorylation	KSPSLPQSSGKHSWN ECCCCCCCCCCCCCC	38.83	22369663
215	Ubiquitination	PSKGLKFKCLVAPSE CCCCCEEEEEECCCC	25.68	23749301

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of POC1_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of POC1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of POC1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
EIF3A_YEAST	RPG1	physical	16554755
RMD5_YEAST	RMD5	physical	16554755
PDC6_YEAST	PDC6	physical	16554755
SPT6_YEAST	SPT6	physical	16554755
IF2A_YEAST	SUI2	physical	16554755
EF3A_YEAST	YEF3	physical	16554755
PSA2_YEAST	PRE8	physical	16554755
HSC82_YEAST	HSC82	physical	16554755
LSP1_YEAST	LSP1	physical	16554755
POC2_YEAST	ADD66	physical	17707236
UMP1_YEAST	UMP1	physical	21499243
POC2_YEAST	ADD66	physical	22930756
RPN4_YEAST	RPN4	genetic	22930756
APC11_YEAST	APC11	genetic	27708008
PRP9_YEAST	PRP9	genetic	27708008
GPI8_YEAST	GPI8	genetic	27708008
PSB3_YEAST	PUP3	genetic	27708008
RPN4_YEAST	RPN4	genetic	27708008
GPR1_YEAST	GPR1	genetic	27708008
RV167_YEAST	RVS167	genetic	27708008
VPS53_YEAST	VPS53	genetic	27708008
YJQ3_YEAST	YJL163C	genetic	27708008
ENV10_YEAST	ENV10	genetic	27708008
ORM2_YEAST	ORM2	genetic	27708008
UBX2_YEAST	UBX2	genetic	27708008
VPS9_YEAST	VPS9	genetic	27708008
RAD14_YEAST	RAD14	genetic	27708008
MKS1_YEAST	MKS1	genetic	27708008
EOS1_YEAST	EOS1	genetic	27708008
SIN3_YEAST	SIN3	genetic	27708008
MDM12_YEAST	MDM12	genetic	27708008
MSC6_YEAST	MSC6	genetic	27708008
TGS1_YEAST	TGS1	genetic	27708008
POC2_YEAST	ADD66	physical	25812915
TCPA_YEAST	TCP1	genetic	29674565
ATC1_YEAST	PMR1	genetic	29674565
CHO2_YEAST	CHO2	genetic	29674565
AXL2_YEAST	AXL2	genetic	29674565
UTP15_YEAST	UTP15	genetic	29674565
LST8_YEAST	LST8	genetic	29674565
MET22_YEAST	MET22	genetic	29674565
TGS1_YEAST	TGS1	genetic	29674565
BUD31_YEAST	BUD31	genetic	29674565
YJY1_YEAST	YJR011C	genetic	29674565

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of POC1_YEAST

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-82, AND MASSSPECTROMETRY.	18407956 [Abstract]