dbPTM

UBL1_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	UBL1_YEAST
UniProt AC	P35127
Protein Name	Ubiquitin carboxyl-terminal hydrolase YUH1
Gene Name	YUH1
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	236
Subcellular Localization
Protein Description	Deubiquitinating enzyme (DUB) that controls levels of cellular ubiquitin through processing of ubiquitin precursors and ubiquitinated proteins. Thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or RUB1. Preferentially cleaves ubiquitin from peptides and small adducts..
Protein Sequence	MSGENRAVVPIESNPEVFTNFAHKLGLKNEWAYFDIYSLTEPELLAFLPRPVKAIVLLFPINEDRKSSTSQQITSSYDVIWFKQSVKNACGLYAILHSLSNNQSLLEPGSDLDNFLKSQSDTSSSKNRFDDVTTDQFVLNVIKENVQTFSTGQSEAPEATADTNLHYITYVEENGGIFELDGRNLSGPLYLGKSDPTATDLIEQELVRVRVASYMENANEEDVLNFAMLGLGPNWE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSGENRAVV ------CCCCCCEEE	55.61	22369663
13	Phosphorylation	RAVVPIESNPEVFTN CEEEECCCCHHHHHH	59.41	22369663
186	Phosphorylation	ELDGRNLSGPLYLGK EECCCCCCCCEECCC	41.75	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of UBL1_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of UBL1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of UBL1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RUB1_YEAST	RUB1	physical	12455997
UBI4P_YEAST	UBI4	physical	10512618
RL40A_YEAST	RPL40B	physical	1429680
RL40B_YEAST	RPL40B	physical	1429680
RS31_YEAST	RPS31	physical	1429680
CTF8_YEAST	CTF8	genetic	17314980
SA185_YEAST	SAP185	genetic	17314980
RPN4_YEAST	RPN4	genetic	20093466
SAC3_YEAST	SAC3	genetic	20093466
RAD51_YEAST	RAD51	genetic	20093466
STB5_YEAST	STB5	genetic	20093466
IF4A_YEAST	TIF2	genetic	20093466
ASF1_YEAST	ASF1	genetic	20093466
IME2_YEAST	IME2	genetic	20093466
FRMSR_YEAST	YKL069W	genetic	20093466
SRN2_YEAST	SRN2	genetic	20093466
FKS1_YEAST	FKS1	genetic	20093466
CDC73_YEAST	CDC73	genetic	20093466
MOT3_YEAST	MOT3	genetic	20093466
LSM7_YEAST	LSM7	genetic	20093466
ADE_YEAST	AAH1	genetic	20093466
PMS1_YEAST	PMS1	genetic	20093466
BUD21_YEAST	BUD21	genetic	20093466
RL40_HUMAN	UBA52	physical	10527495
UBI4P_YEAST	UBI4	physical	10413498
UBC_HUMAN	UBC	physical	24961813
CEM1_YEAST	CEM1	genetic	27708008
IF4A_YEAST	TIF2	genetic	27708008
LSM7_YEAST	LSM7	genetic	27708008
PMA2_YEAST	PMA2	genetic	27708008
INO4_YEAST	INO4	genetic	27453043
SYFM_YEAST	MSF1	genetic	27453043
CCR4_YEAST	CCR4	genetic	27453043
DCOR_YEAST	SPE1	genetic	27453043
PHSG_YEAST	GPH1	genetic	27453043
DCAM_YEAST	SPE2	genetic	27453043

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of UBL1_YEAST

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-186, AND MASSSPECTROMETRY.	18407956 [Abstract]