| UniProt ID | ARL1_YEAST | |
|---|---|---|
| UniProt AC | P38116 | |
| Protein Name | ADP-ribosylation factor-like protein 1 | |
| Gene Name | ARL1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 183 | |
| Subcellular Localization | Golgi apparatus . | |
| Protein Description | Recruits golgins such as IMH1 to the Golgi. Can bind and hydrolyze GTP. May be involved in trafficking events within the endosomal system.. | |
| Protein Sequence | MGNIFSSMFDKLWGSNKELRILILGLDGAGKTTILYRLQIGEVVTTKPTIGFNVETLSYKNLKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAALLVFANKQDQPGALSASEVSKELNLVELKDRSWSIVASSAIKGEGITEGLDWLIDVIKEEQL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | N-myristoyl glycine | ------MGNIFSSMF ------CCCHHHHHH | 35.62 | - | |
| 2 | Myristoylation | ------MGNIFSSMF ------CCCHHHHHH | 35.62 | 9388248 | |
| 136 | Phosphorylation | QDQPGALSASEVSKE CCCCCCCCHHHHHHH | 29.25 | 22369663 | |
| 138 | Phosphorylation | QPGALSASEVSKELN CCCCCCHHHHHHHCC | 34.84 | 22369663 | |
| 141 | Phosphorylation | ALSASEVSKELNLVE CCCHHHHHHHCCCEE | 19.16 | 22369663 | |
| 142 | Acetylation | LSASEVSKELNLVEL CCHHHHHHHCCCEEE | 71.98 | 24489116 | |
| 150 | Ubiquitination | ELNLVELKDRSWSIV HCCCEEECCCCEEEE | 37.27 | 24961812 | |
| 150 | Acetylation | ELNLVELKDRSWSIV HCCCEEECCCCEEEE | 37.27 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARL1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARL1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARL1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Myristoylation | |
| Reference | PubMed |
| "Characterization of an ADP-ribosylation factor-like 1 protein inSaccharomyces cerevisiae."; Lee F.-J.S., Huang C.F., Yu W.L., Buu L.M., Lin C.Y., Huang M.C.,Moss J., Vaughan M.; J. Biol. Chem. 272:30998-31005(1997). Cited for: NUCLEOTIDE SEQUENCE [MRNA], CHARACTERIZATION, AND MYRISTOYLATION ATGLY-2. | |
