DFM1_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DFM1_YEAST
• UniProt AC: Q12743
• Protein Name: DER1-like family member protein 1
• Gene Name: DFM1
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 341
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein .
• Protein Description: May be involved in the degradation process of some misfolded endoplasmic reticulum (ER) luminal proteins. Its precise role is however unclear and its inability to complement der1 mutations, suggests either that it is not involved in degradation process of misfolded proteins, or that it participates in the destruction of specific misfolded ER luminal proteins..
• Protein Sequence: MAGPRNVRTLHGNGGRNNDVMGPKEFWLNIPPITRTLFTLAIVMTIVGRLNLINPWYFIYVWNLTFKKVQIWRLLTSCVMLSSRAMPALMELYSIYDRSSQLERGHFGPGLSNRRGPMVTVDYAYYLCFCILAITTATTIIYGSYYPVVLTSGFISCITYTWSIDNANVQIMFYGLIPVWGKYFPLIQLFISFVFNEGDFVISLIGFTTGYLYTCLDTHTLGPIWGMISRKADPTYGISPNGKFSTPWWFTSLYARITGAHNETATFNNNFANVPSSQRETRTFSGRGQRLGTAPATLSQTSGTDSGRASGSQLRSGPSNLNQFQGRGQRVGQTNSPSDSQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
231	Ubiquitination	IWGMISRKADPTYGI HHHHHCCCCCCCCCC	50.80	23749301
299	Phosphorylation	GTAPATLSQTSGTDS CCCCEEEECCCCCCC	27.36	30377154
301	Phosphorylation	APATLSQTSGTDSGR CCEEEECCCCCCCCC	26.25	30377154
306	Phosphorylation	SQTSGTDSGRASGSQ ECCCCCCCCCCCCCC	29.98	23749301
310	Phosphorylation	GTDSGRASGSQLRSG CCCCCCCCCCCCCCC	37.30	27017623
312	Phosphorylation	DSGRASGSQLRSGPS CCCCCCCCCCCCCCC	24.44	28889911
316	Phosphorylation	ASGSQLRSGPSNLNQ CCCCCCCCCCCCHHH	64.74	22369663
319	Phosphorylation	SQLRSGPSNLNQFQG CCCCCCCCCHHHCCC	58.43	22369663
336	Phosphorylation	QRVGQTNSPSDSQ-- CCCCCCCCCCCCC--	29.21	23749301
338	Phosphorylation	VGQTNSPSDSQ---- CCCCCCCCCCC----	50.11	28889911
340	Phosphorylation	QTNSPSDSQ------ CCCCCCCCC------	41.97	23749301

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DFM1_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DFM1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DFM1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDC48_YEAST	CDC48	physical	17083136
PMT4_YEAST	PMT4	genetic	16269340
ORM2_YEAST	ORM2	genetic	16269340
PGA3_YEAST	PGA3	genetic	16269340
ARL1_YEAST	ARL1	genetic	16269340
ARL3_YEAST	ARL3	genetic	16269340
UIP3_YEAST	UIP3	physical	18719252
UBX7_YEAST	UBX7	physical	18719252
MPS3_YEAST	MPS3	physical	18719252
PEX29_YEAST	PEX29	physical	18719252
USA1_YEAST	USA1	physical	18719252
DFM1_YEAST	DFM1	physical	18407841
CDC48_YEAST	CDC48	physical	18407841
HRD1_YEAST	HRD1	physical	18407841
HRD3_YEAST	HRD3	physical	18407841
NPL4_YEAST	NPL4	physical	18407841
UBX2_YEAST	UBX2	physical	18407841
USA1_YEAST	USA1	physical	18407841
OS9_YEAST	YOS9	physical	18407841
MDM10_YEAST	MDM10	genetic	20093466
HSP30_YEAST	HSP30	genetic	20093466
ODO2_YEAST	KGD2	genetic	20093466
VTC1_YEAST	VTC1	genetic	20093466
ZRT1_YEAST	ZRT1	genetic	20093466
VAM7_YEAST	VAM7	genetic	20093466
AAKG_YEAST	SNF4	genetic	20093466
SAC1_YEAST	SAC1	genetic	20093466
SWI6_YEAST	SWI6	genetic	20093466
MDM12_YEAST	MDM12	genetic	20093466
CSK2C_YEAST	CKB2	genetic	20093466
PMA2_YEAST	PMA2	genetic	20093466
DER1_YEAST	DER1	physical	20579315
HRD3_YEAST	HRD3	physical	20579315
HRD1_YEAST	HRD1	physical	20579315
CDC48_YEAST	CDC48	physical	20579315
DOA10_YEAST	SSM4	physical	20579315

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.