UniProt ID | VTC1_YEAST | |
---|---|---|
UniProt AC | P40046 | |
Protein Name | Vacuolar transporter chaperone 1 | |
Gene Name | VTC1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 129 | |
Subcellular Localization |
Vacuole membrane Multi-pass membrane protein . |
|
Protein Description | Component of the vacuolar transporter chaperone (VTC) complex, which plays a role in vacuolar membrane fusion. Required for SEC18/NSF activity in SNARE priming, membrane binding of LMA1 and V(0) trans-complex formation.. | |
Protein Sequence | MSSAPLLQRTPGKKIALPTRVEPKVFFANERTFLSWLNFTVMLGGLGVGLLNFGDKIGRVSAGLFTFVAMGTMIYALVTYHWRAAAIRRRGSGPYDDRLGPTLLCFFLLVAVIINFILRLKYNDANTKL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSSAPLLQR ------CCCCCCCCC | 34.90 | 22814378 | |
2 | Phosphorylation | ------MSSAPLLQR ------CCCCCCCCC | 34.90 | 22369663 | |
3 | Phosphorylation | -----MSSAPLLQRT -----CCCCCCCCCC | 32.38 | 22369663 | |
10 | Phosphorylation | SAPLLQRTPGKKIAL CCCCCCCCCCCCEEC | 24.35 | 28152593 | |
24 | Ubiquitination | LPTRVEPKVFFANER CCCCCCCEEEECCCH | 37.86 | 24961812 | |
24 | Acetylation | LPTRVEPKVFFANER CCCCCCCEEEECCCH | 37.86 | 24489116 | |
24 | Succinylation | LPTRVEPKVFFANER CCCCCCCEEEECCCH | 37.86 | 23954790 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VTC1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VTC1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VTC1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...