UniProt ID | DTD_YEAST | |
---|---|---|
UniProt AC | Q07648 | |
Protein Name | D-aminoacyl-tRNA deacylase {ECO:0000250|UniProtKB:Q8IIS0} | |
Gene Name | DTD1 {ECO:0000303|PubMed:10766779} | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 150 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | An aminoacyl-tRNA editing enzyme that deacylates mischarged D-aminoacyl-tRNAs (Probable). Hydrolyzes D-tyrosyl-tRNA(Tyr) into D-tyrosine and free tRNA(Tyr). [PubMed: 10766779 May also deacylate mischarged D-leucyl-tRNA(Leu)] | |
Protein Sequence | MKIVLQKVSQASVVVDSKVISSIKHGYMLLVGISIDDSMAEIDKLSKKVLSLRIFEDESRNLWKKNIKEANGEILSVSQFTLMAKTKKGTKPDFHLAQKGHIAKELYEEFLKLLRSDLGEEKVKDGEFGAMMSCSLTNEGPVTIILDSDQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Ubiquitination | -MKIVLQKVSQASVV -CCEEEEECCCCEEE | 39.43 | 24961812 | |
104 | Acetylation | AQKGHIAKELYEEFL HHHCCHHHHHHHHHH | 47.88 | 24489116 | |
133 | Phosphorylation | GEFGAMMSCSLTNEG CCCEEEEEEECCCCC | 6.35 | 27017623 | |
135 | Phosphorylation | FGAMMSCSLTNEGPV CEEEEEEECCCCCCE | 30.81 | 27017623 | |
148 | Phosphorylation | PVTIILDSDQ----- CEEEEEECCC----- | 34.17 | 27017623 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DTD_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DTD_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DTD_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...