RCR1_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RCR1_YEAST
• UniProt AC: P38212
• Protein Name: Protein RCR1
• Gene Name: RCR1
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 213
• Subcellular Localization: Endoplasmic reticulum membrane ; Single-pass type I membrane protein .
• Protein Description: Regulates chitin deposition in the cell wall..
• Protein Sequence: MGLISYENEAINEVKKADNHHVSKFVTSYYGPSSSSWQSGIWILFVLFVAAVILIILFTFVANRRRRRMGRAPIRGTAWLTPPSYRQSQQQYTGTVQQRTDDYVPEYTETANEHDLGYYDQRGEFHPNDKAAYVAPPPLVQECSSESVNSLERPPAAVVHQANSLDTDYGLTRPSNGRVPAVSDTVEQLERLPGGTTTQEINPPERAKVNARS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MGLISYENEAIN ---CCCCCCCHHHHH	31.28	29136822
6	Phosphorylation	--MGLISYENEAINE --CCCCCCCHHHHHH	18.77	29136822
93	Phosphorylation	RQSQQQYTGTVQQRT HHCCHHCCEECCCCC	23.26	23749301
164	Phosphorylation	AVVHQANSLDTDYGL CEEEECCCCCCCCCC	30.55	28889911
183	Phosphorylation	NGRVPAVSDTVEQLE CCCCCCCCCHHHHHH	29.66	27214570
185	Phosphorylation	RVPAVSDTVEQLERL CCCCCCCHHHHHHCC	20.59	27214570

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	RSP5	P39940	PMID:22199232

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RCR1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RCR1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RCR2_YEAST	RCR2	genetic	15590673
RSP5_YEAST	RSP5	physical	17213653
PMT2_YEAST	PMT2	genetic	15590673
PGA14_YEAST	YNL190W	genetic	23891562

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"A multidimensional chromatography technology for in-depthphosphoproteome analysis.";
Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.;
Mol. Cell. Proteomics 7:1389-1396(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-164, AND MASSSPECTROMETRY.
PubMed: 18407956