UniProt ID | RCR1_YEAST | |
---|---|---|
UniProt AC | P38212 | |
Protein Name | Protein RCR1 | |
Gene Name | RCR1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 213 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type I membrane protein . |
|
Protein Description | Regulates chitin deposition in the cell wall.. | |
Protein Sequence | MGLISYENEAINEVKKADNHHVSKFVTSYYGPSSSSWQSGIWILFVLFVAAVILIILFTFVANRRRRRMGRAPIRGTAWLTPPSYRQSQQQYTGTVQQRTDDYVPEYTETANEHDLGYYDQRGEFHPNDKAAYVAPPPLVQECSSESVNSLERPPAAVVHQANSLDTDYGLTRPSNGRVPAVSDTVEQLERLPGGTTTQEINPPERAKVNARS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MGLISYENEAIN ---CCCCCCCHHHHH | 31.28 | 29136822 | |
6 | Phosphorylation | --MGLISYENEAINE --CCCCCCCHHHHHH | 18.77 | 29136822 | |
93 | Phosphorylation | RQSQQQYTGTVQQRT HHCCHHCCEECCCCC | 23.26 | 23749301 | |
164 | Phosphorylation | AVVHQANSLDTDYGL CEEEECCCCCCCCCC | 30.55 | 28889911 | |
183 | Phosphorylation | NGRVPAVSDTVEQLE CCCCCCCCCHHHHHH | 29.66 | 27214570 | |
185 | Phosphorylation | RVPAVSDTVEQLERL CCCCCCCHHHHHHCC | 20.59 | 27214570 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RCR1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RCR1_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RCR2_YEAST | RCR2 | genetic | 15590673 | |
RSP5_YEAST | RSP5 | physical | 17213653 | |
PMT2_YEAST | PMT2 | genetic | 15590673 | |
PGA14_YEAST | YNL190W | genetic | 23891562 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-164, AND MASSSPECTROMETRY. |