| UniProt ID | PGA14_YEAST | |
|---|---|---|
| UniProt AC | P53872 | |
| Protein Name | Hydrophilin YNL190W | |
| Gene Name | YNL190W | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 204 | |
| Subcellular Localization |
Secreted, cell wall . Membrane Lipid-anchor, GPI-anchor . |
|
| Protein Description | Hydrophilin which is essential to overcome the simple stress of the desiccation-rehydration process.. | |
| Protein Sequence | MKFSSVTAITLATVATVATAKKGEHDFTTTLTLSSDGSLTTTTSTHTTHKYGKFNKTSKSKTPNHTGTHKYGKFNKTSKSKTPNHTGTHKYGKFNKTSKSKTPNHTGTHKYGKFNKTSKSKTPNHTGTHKYGKFNKTSKSKTPNHTGTHKYGKFNKTKHDTTTYGPGEKARKNNAAPGPSNFNSIKLFGVTAGSAAVAGALLLL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 55 | N-linked_Glycosylation | THKYGKFNKTSKSKT EEECCCCCCCCCCCC | - | ||
| 64 | N-linked_Glycosylation | TSKSKTPNHTGTHKY CCCCCCCCCCCCCCC | - | ||
| 75 | N-linked_Glycosylation | THKYGKFNKTSKSKT CCCCCCCCCCCCCCC | - | ||
| 84 | N-linked_Glycosylation | TSKSKTPNHTGTHKY CCCCCCCCCCCCCCC | - | ||
| 95 | N-linked_Glycosylation | THKYGKFNKTSKSKT CCCCCCCCCCCCCCC | - | ||
| 104 | N-linked_Glycosylation | TSKSKTPNHTGTHKY CCCCCCCCCCCCCCC | - | ||
| 115 | N-linked_Glycosylation | THKYGKFNKTSKSKT CCCCCCCCCCCCCCC | - | ||
| 124 | N-linked_Glycosylation | TSKSKTPNHTGTHKY CCCCCCCCCCCCCCC | - | ||
| 135 | N-linked_Glycosylation | THKYGKFNKTSKSKT CCCCCCCCCCCCCCC | - | ||
| 144 | N-linked_Glycosylation | TSKSKTPNHTGTHKY CCCCCCCCCCCCCCC | - | ||
| 155 | N-linked_Glycosylation | THKYGKFNKTKHDTT CCCCCCCCCCCCCCC | - | ||
| 174 | GPI-anchor | GEKARKNNAAPGPSN CHHHHHCCCCCCCCC | 10383953 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PGA14_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PGA14_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PGA14_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
