UniProt ID | RIFK_YEAST | |
---|---|---|
UniProt AC | Q03778 | |
Protein Name | Riboflavin kinase | |
Gene Name | FMN1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 218 | |
Subcellular Localization | Microsome . Mitochondrion inner membrane . Endoplasmic reticulum . 90% microsomal. 10% mitochondrial. Found to be present in the inner membrane of mitochondria. The C-terminus is located in the matrix. | |
Protein Description | Catalyzes the phosphorylation of riboflavin (vitamin B2) to form flavin mononucleotide (FMN) coenzyme.. | |
Protein Sequence | MFTWTIYVSLLLVLAGTFLMNRNTNTDIIDTFKREVDLPIPAQPGPPFPLVTDYCDIVCGFGRGSAELGIPTANVPINQLPKGINDLDLGVYFGFAHIKTVDGQELSVETRRDGRTVVYNYGQYLSEANDDLSVLPMVLSVGKNPFYGNDFKTMELHIIHDFKNDFYGARVKFNILGHIRPELNYTTKEALIEDINIDIRTAQTVLATPPYQVFKQQL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MFTWTIYVSL -----CCHHHHHHHH | 22.02 | 28132839 | |
5 | Phosphorylation | ---MFTWTIYVSLLL ---CCHHHHHHHHHH | 10.20 | 28132839 | |
7 | Phosphorylation | -MFTWTIYVSLLLVL -CCHHHHHHHHHHHH | 4.07 | 28889911 | |
17 | Phosphorylation | LLLVLAGTFLMNRNT HHHHHHHHHHHCCCC | 14.16 | 28132839 | |
147 | Phosphorylation | SVGKNPFYGNDFKTM EECCCCCCCCCCCCE | 19.10 | 28152593 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RIFK_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RIFK_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RIFK_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UTP5_YEAST | UTP5 | physical | 10688190 | |
PIG2_YEAST | PIG2 | genetic | 19269370 | |
6PGD1_YEAST | GND1 | genetic | 21623372 | |
TGL2_YEAST | TGL2 | genetic | 21623372 | |
ELO2_YEAST | ELO2 | genetic | 21623372 | |
FOLE_YEAST | MET7 | genetic | 21623372 | |
DCOR_YEAST | SPE1 | genetic | 21623372 | |
PFKA1_YEAST | PFK1 | genetic | 21623372 | |
ADH3_YEAST | ADH3 | genetic | 21623372 | |
APC11_YEAST | APC11 | genetic | 27708008 | |
RPN5_YEAST | RPN5 | genetic | 27708008 | |
GLE1_YEAST | GLE1 | genetic | 27708008 | |
TIM22_YEAST | TIM22 | genetic | 27708008 | |
FAL1_YEAST | FAL1 | genetic | 27708008 | |
MOB2_YEAST | MOB2 | genetic | 27708008 | |
MED6_YEAST | MED6 | genetic | 27708008 | |
PRP19_YEAST | PRP19 | genetic | 27708008 | |
TAD3_YEAST | TAD3 | genetic | 27708008 | |
RSC9_YEAST | RSC9 | genetic | 27708008 | |
ERO1_YEAST | ERO1 | genetic | 27708008 | |
MCM1_YEAST | MCM1 | genetic | 27708008 | |
DYR_YEAST | DFR1 | genetic | 27708008 | |
TIM50_YEAST | TIM50 | genetic | 27708008 | |
DCOR_YEAST | SPE1 | genetic | 27708008 | |
EIF3J_YEAST | HCR1 | genetic | 27708008 | |
SIW14_YEAST | SIW14 | genetic | 27708008 | |
PHO80_YEAST | PHO80 | genetic | 27708008 | |
YME1_YEAST | YME1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-147, AND MASSSPECTROMETRY. |