| UniProt ID | HAC1_YEAST | |
|---|---|---|
| UniProt AC | P41546 | |
| Protein Name | Transcriptional activator HAC1 | |
| Gene Name | HAC1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 238 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Transcriptional activator involved in the unfolded protein response (UPR) pathway. Recognizes and binds to the UPR element (UPRE) in the promoter of UPR-regulated genes such as KAR2, PDI1, EUG1 and FKB2. Increases the synthesis of endoplasmic reticulum-resident proteins required for protein folding as well as components of the secretory pathway.. | |
| Protein Sequence | MEMTDFELTSNSQSNLAIPTNFKSTLPPRKRAKTKEEKEQRRIERILRNRRAAHQSREKKRLHLQYLERKCSLLENLLNSVNLEKLADHEDALTCSHDAFVASLDEYRDFQSTRGASLDTRASSHSSSDTFTPSPLNCTMEPATLSPKSMRDSASDQETSWELQMFKTENVPESTTLPAVDNNNLFDAVASPLADPLCDDIAGNSLPFDNSIDLDNWRNPEAQSGLNSFELNDFFITS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 38 | Acetylation | RAKTKEEKEQRRIER CCCCHHHHHHHHHHH | 61.31 | 23572591 | |
| 128 | Phosphorylation | RASSHSSSDTFTPSP CCCCCCCCCCCCCCC | 43.62 | 19779198 | |
| 130 | Phosphorylation | SSHSSSDTFTPSPLN CCCCCCCCCCCCCCC | 31.21 | 19779198 | |
| 132 | Phosphorylation | HSSSDTFTPSPLNCT CCCCCCCCCCCCCCE | 25.58 | 27017623 | |
| 134 | Phosphorylation | SSDTFTPSPLNCTME CCCCCCCCCCCCEEC | 38.67 | 27017623 | |
| 139 | Phosphorylation | TPSPLNCTMEPATLS CCCCCCCEECCCCCC | 24.40 | 19779198 | |
| 144 | Phosphorylation | NCTMEPATLSPKSMR CCEECCCCCCCHHHC | 38.18 | 23749301 | |
| 146 | Phosphorylation | TMEPATLSPKSMRDS EECCCCCCCHHHCCC | 26.40 | 23749301 | |
| 153 | Phosphorylation | SPKSMRDSASDQETS CCHHHCCCCCCCCCC | 21.21 | 27017623 | |
| 155 | Phosphorylation | KSMRDSASDQETSWE HHHCCCCCCCCCCCH | 43.72 | 19779198 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HAC1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HAC1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
