TRM7_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TRM7_YEAST
• UniProt AC: P38238
• Protein Name: tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase
• Gene Name: TRM7 {ECO:0000255|HAMAP-Rule:MF_03162}
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 310
• Subcellular Localization: Cytoplasm .
• Protein Description: Methylates the 2'-O-ribose of nucleotides at positions 32 and 34 of the tRNA anticodon loop of tRNA(Phe), tRNA(Trp) and tRNA(Leu(UAA)). Requires TRM732 for methylation of the cytidine at position 32 and RTT10/TRM734 for methylation of the nucleotides at position 34 in substrate tRNAs. Lack of either of these modifications in tRNA(Phe) reduces formation of wybutosine from 1-methylguanosine at position 37..
• Protein Sequence: MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLKRVVDLCAAPGSWSQVLSRKLFDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNEKADFVCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGYLFDKIVCAKPRSSRGTSLEAFIVCLGYNPPSNWTPKLDVNTSVDEFFQGCFLNKLCISDKLSHWNEEERNIAEFMACGSLQSFDSDATYHDLPSSVAGTSSSLDPVQSPTNPPYKKALELKRSGKLTRSV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
69	Phosphorylation	SRKLFDESPSSDKED HHHHCCCCCCCCHHC	31.74	28889911
71	Phosphorylation	KLFDESPSSDKEDRK HHCCCCCCCCHHCCC	61.52	28889911
72	Phosphorylation	LFDESPSSDKEDRKI HCCCCCCCCHHCCCE	56.96	28889911
81	Phosphorylation	KEDRKIVSVDLQPMS HHCCCEEEEECCCCC	17.24	22369663
88	Phosphorylation	SVDLQPMSPIPHVTT EEECCCCCCCCCEEE	26.76	22369663
94	Phosphorylation	MSPIPHVTTLQADIT CCCCCCEEEEECCCC	20.82	22369663
95	Phosphorylation	SPIPHVTTLQADITH CCCCCEEEEECCCCC	18.78	22369663
101	Phosphorylation	TTLQADITHPKTLAR EEEECCCCCHHHHHH	32.45	22369663
111	Acetylation	KTLARILKLFGNEKA HHHHHHHHHHCCCCC	39.12	24489116
240	Acetylation	NKLCISDKLSHWNEE HHHHHHHHHHCCCHH	45.13	24489116
288	Phosphorylation	SSLDPVQSPTNPPYK CCCCCCCCCCCCCHH	33.65	19823750
290	Phosphorylation	LDPVQSPTNPPYKKA CCCCCCCCCCCHHHH	66.65	19823750
294	Phosphorylation	QSPTNPPYKKALELK CCCCCCCHHHHHHHH	26.78	19823750

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TRM7_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TRM7_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TRM7_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TRM7_YEAST	TRM7	physical	14759368
SN114_YEAST	SNU114	genetic	19061648
LTV1_YEAST	LTV1	genetic	19061648
TR732_YEAST	TRM732	physical	20826334
TR732_YEAST	TRM732	physical	22912484
WDR6_YEAST	RTT10	physical	22912484
TRM1_YEAST	TRM1	genetic	22912484
SAF1_YEAST	SAF1	genetic	27708008
STDH_YEAST	CHA1	genetic	27708008
YCZ2_YEAST	YCR102C	genetic	27708008
EXG2_YEAST	EXG2	genetic	27708008
YFAS1_YEAST	YDR262W	genetic	27708008
GCN20_YEAST	GCN20	genetic	27708008
AIM34_YEAST	AIM34	genetic	27708008
SRT1_YEAST	SRT1	genetic	27708008
SPG5_YEAST	SPG5	genetic	27708008
WHI5_YEAST	WHI5	genetic	27708008
RDL1_YEAST	RDL1	genetic	27708008
EF1G1_YEAST	CAM1	genetic	27708008
SRO7_YEAST	SRO7	genetic	27708008
SYFB_YEAST	FRS1	genetic	27811238

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.