UniProt ID | TRM7_YEAST | |
---|---|---|
UniProt AC | P38238 | |
Protein Name | tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase | |
Gene Name | TRM7 {ECO:0000255|HAMAP-Rule:MF_03162} | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 310 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Methylates the 2'-O-ribose of nucleotides at positions 32 and 34 of the tRNA anticodon loop of tRNA(Phe), tRNA(Trp) and tRNA(Leu(UAA)). Requires TRM732 for methylation of the cytidine at position 32 and RTT10/TRM734 for methylation of the nucleotides at position 34 in substrate tRNAs. Lack of either of these modifications in tRNA(Phe) reduces formation of wybutosine from 1-methylguanosine at position 37.. | |
Protein Sequence | MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLKRVVDLCAAPGSWSQVLSRKLFDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNEKADFVCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGYLFDKIVCAKPRSSRGTSLEAFIVCLGYNPPSNWTPKLDVNTSVDEFFQGCFLNKLCISDKLSHWNEEERNIAEFMACGSLQSFDSDATYHDLPSSVAGTSSSLDPVQSPTNPPYKKALELKRSGKLTRSV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
69 | Phosphorylation | SRKLFDESPSSDKED HHHHCCCCCCCCHHC | 31.74 | 28889911 | |
71 | Phosphorylation | KLFDESPSSDKEDRK HHCCCCCCCCHHCCC | 61.52 | 28889911 | |
72 | Phosphorylation | LFDESPSSDKEDRKI HCCCCCCCCHHCCCE | 56.96 | 28889911 | |
81 | Phosphorylation | KEDRKIVSVDLQPMS HHCCCEEEEECCCCC | 17.24 | 22369663 | |
88 | Phosphorylation | SVDLQPMSPIPHVTT EEECCCCCCCCCEEE | 26.76 | 22369663 | |
94 | Phosphorylation | MSPIPHVTTLQADIT CCCCCCEEEEECCCC | 20.82 | 22369663 | |
95 | Phosphorylation | SPIPHVTTLQADITH CCCCCEEEEECCCCC | 18.78 | 22369663 | |
101 | Phosphorylation | TTLQADITHPKTLAR EEEECCCCCHHHHHH | 32.45 | 22369663 | |
111 | Acetylation | KTLARILKLFGNEKA HHHHHHHHHHCCCCC | 39.12 | 24489116 | |
240 | Acetylation | NKLCISDKLSHWNEE HHHHHHHHHHCCCHH | 45.13 | 24489116 | |
288 | Phosphorylation | SSLDPVQSPTNPPYK CCCCCCCCCCCCCHH | 33.65 | 19823750 | |
290 | Phosphorylation | LDPVQSPTNPPYKKA CCCCCCCCCCCHHHH | 66.65 | 19823750 | |
294 | Phosphorylation | QSPTNPPYKKALELK CCCCCCCHHHHHHHH | 26.78 | 19823750 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRM7_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRM7_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRM7_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TRM7_YEAST | TRM7 | physical | 14759368 | |
SN114_YEAST | SNU114 | genetic | 19061648 | |
LTV1_YEAST | LTV1 | genetic | 19061648 | |
TR732_YEAST | TRM732 | physical | 20826334 | |
TR732_YEAST | TRM732 | physical | 22912484 | |
WDR6_YEAST | RTT10 | physical | 22912484 | |
TRM1_YEAST | TRM1 | genetic | 22912484 | |
SAF1_YEAST | SAF1 | genetic | 27708008 | |
STDH_YEAST | CHA1 | genetic | 27708008 | |
YCZ2_YEAST | YCR102C | genetic | 27708008 | |
EXG2_YEAST | EXG2 | genetic | 27708008 | |
YFAS1_YEAST | YDR262W | genetic | 27708008 | |
GCN20_YEAST | GCN20 | genetic | 27708008 | |
AIM34_YEAST | AIM34 | genetic | 27708008 | |
SRT1_YEAST | SRT1 | genetic | 27708008 | |
SPG5_YEAST | SPG5 | genetic | 27708008 | |
WHI5_YEAST | WHI5 | genetic | 27708008 | |
RDL1_YEAST | RDL1 | genetic | 27708008 | |
EF1G1_YEAST | CAM1 | genetic | 27708008 | |
SRO7_YEAST | SRO7 | genetic | 27708008 | |
SYFB_YEAST | FRS1 | genetic | 27811238 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...