| UniProt ID | SRT1_YEAST | |
|---|---|---|
| UniProt AC | Q03175 | |
| Protein Name | Dehydrodolichyl diphosphate synthase complex subunit SRT1 {ECO:0000305} | |
| Gene Name | SRT1 {ECO:0000312|SGD:S000004707} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 343 | |
| Subcellular Localization | Lipid droplet . | |
| Protein Description | With NUS1, forms the dehydrodolichyl diphosphate synthase (DDS) complex, an essential component of the dolichol monophosphate (Dol-P) biosynthetic machinery. Adds multiple copies of isopentenyl pyrophosphate (IPP) to farnesyl pyrophosphate (FPP) to produce dehydrodolichyl diphosphate (Dedol-PP), a precursor of dolichol which is utilized as a sugar carrier in protein glycosylation in the endoplasmic reticulum (ER).. | |
| Protein Sequence | MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFYVNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLLTLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAKDYKDPLYGSKIRIVGDQSLLSPEMRKKIKKVEEITQDGDDFTLFICFPYTSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTSGHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKYNEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 221 | Phosphorylation | EDHLENKSPRINIRK HHHHHCCCCCEEHHH | 30.87 | 27214570 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SRT1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SRT1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SRT1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
